MT2A Antibody - #DF6755
![](/images/pubmed.gif)
Product: | MT2A Antibody |
Catalog: | DF6755 |
Description: | Rabbit polyclonal antibody to MT2A |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Dog |
Mol.Wt.: | 7kDa; 6kD(Calculated). |
Uniprot: | P02795 |
RRID: | AB_2838717 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6755, RRID:AB_2838717.
Fold/Unfold
CES 1; CES1; Metallothionein 1A; Metallothionein 1S; Metallothionein 2; Metallothionein 2A; Metallothionein IA; Metallothionein II; Metallothionein-1A; Metallothionein-IA; Metallothionein2; MGC32848; MT 1A; MT 2; MT 2A; MT IA; MT II; MT-1A; MT-IA; MT1; MT1A; MT1A_HUMAN; MT1S; MT2; MT2A; MTC;
Immunogens
- P02795 MT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P02795 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S6 | Phosphorylation | Uniprot | |
S12 | Phosphorylation | Uniprot | |
T14 | Phosphorylation | Uniprot | |
S18 | Phosphorylation | Uniprot | |
K22 | Acetylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
S35 | Phosphorylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
K51 | Acetylation | Uniprot | |
K51 | Ubiquitination | Uniprot | |
K56 | Ubiquitination | Uniprot | |
S58 | Phosphorylation | Uniprot |
Research Backgrounds
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Class I metallothioneins contain 2 metal-binding domains: four divalent ions are chelated within cluster A of the alpha domain and are coordinated via cysteinyl thiolate bridges to 11 cysteine ligands. Cluster B, the corresponding region within the beta domain, can ligate three divalent ions to 9 cysteines.
Belongs to the metallothionein superfamily. Type 1 family.
Research Fields
· Organismal Systems > Digestive system > Mineral absorption.
References
Application: WB Species: Human Sample: BEAS-2B cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.