PTP4A3 Antibody - #DF6747

Product: | PTP4A3 Antibody |
Catalog: | DF6747 |
Description: | Rabbit polyclonal antibody to PTP4A3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 15~26kD; 20kD(Calculated). |
Uniprot: | O75365 |
RRID: | AB_2838709 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6747, RRID:AB_2838709.
Fold/Unfold
Potentially prenylated protein tyrosine phosphatase; PRL 3; PRL R; PRL-3; PRL-R; PRL3; PRLR; Protein tyrosine phosphatase 4a3; Protein tyrosine phosphatase type IVA 3; Protein-tyrosine phosphatase 4a3; Protein-tyrosine phosphatase of regenerating liver 3; PTP 4A3; PTP4A3; TP4A3_HUMAN;
Immunogens
Mainly expressed in cardiomyocytes and skeletal muscle; also found in pancreas. Consistently overexpressed in colon cancer metastasis.
- O75365 TP4A3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75365 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S13 | Phosphorylation | Uniprot | |
Y14 | Phosphorylation | Uniprot | |
K155 | Acetylation | Uniprot | |
K167 | Acetylation | Uniprot |
Research Backgrounds
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypertrophy by inhibiting intracellular calcium mobilization in response to angiotensin II.
Farnesylated. Farnesylation is required for membrane targeting (By similarity).
Cell membrane. Early endosome.
Mainly expressed in cardiomyocytes and skeletal muscle; also found in pancreas. Consistently overexpressed in colon cancer metastasis.
Interacts with tubulin.
Belongs to the protein-tyrosine phosphatase family.
References
Application: WB Species: Human Sample: U87MG cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.