S100A10 Antibody - #DF6738
![](/images/pubmed.gif)
Product: | S100A10 Antibody |
Catalog: | DF6738 |
Description: | Rabbit polyclonal antibody to S100A10 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 11kDa; 11kD(Calculated). |
Uniprot: | P60903 |
RRID: | AB_2838700 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6738, RRID:AB_2838700.
Fold/Unfold
42C; AA409961; AL024248; Annexin II ligand; Annexin II ligand, calpactin I, light polypeptide; Annexin II tetramer (AIIt) p11 subunit; Annexin II, light chain; ANX2L; ANX2LG; Ca[1]; CAL12; CAL1L; Calpactin I light chain; Calpactin I, p11 subunit; Calpactin-1 light chain; Cellular ligand of annexin II; CLP11; GP11; MGC111133; Nerve growth factor-induced protein 42C; OTTHUMP00000015269; OTTHUMP00000015270; p10; p10 protein; p11; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium binding protein A10 (calpactin); S100 calcium binding protein A10; S100 calcium-binding protein A10; S100a10; S10AA_HUMAN;
Immunogens
- P60903 S10AA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P60903 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S3 | Phosphorylation | Uniprot | |
T11 | Phosphorylation | Uniprot | |
K18 | Ubiquitination | Uniprot | |
K23 | Acetylation | Uniprot | |
K23 | Ubiquitination | Uniprot | |
Y25 | Phosphorylation | Uniprot | |
T27 | Phosphorylation | Uniprot | |
K28 | Acetylation | Uniprot | |
K28 | Ubiquitination | Uniprot | |
K37 | Acetylation | Uniprot | |
K37 | Ubiquitination | Uniprot | |
K47 | Ubiquitination | Uniprot | |
K54 | Acetylation | Uniprot | |
K54 | Ubiquitination | Uniprot | |
K57 | Acetylation | Uniprot | |
K57 | Ubiquitination | Uniprot | |
Y86 | Phosphorylation | Uniprot |
Research Backgrounds
Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
Heterotetramer containing 2 light chains of S100A10/p11 and 2 heavy chains of ANXA2/p36. Interacts with SCN10A (By similarity).
Belongs to the S-100 family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.