Product: MSMB Antibody
Catalog: DF6720
Description: Rabbit polyclonal antibody to MSMB
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 13kDa; 13kD(Calculated).
Uniprot: P08118
RRID: AB_2838682

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
MSMB Antibody detects endogenous levels of total MSMB.
RRID:
AB_2838682
Cite Format: Affinity Biosciences Cat# DF6720, RRID:AB_2838682.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta microseminoprotein [Precursor]; Beta-microseminoprotein; HPC 13; HPC13; IGBF; Immunoglobulin binding factor; Immunoglobulin-binding factor; microseminoprotein beta; Msmb; MSMB_HUMAN; MSP; MSPB; PN 44; PN44; Prostate secreted seminal plasma protein; Prostate secretory protein of 94 amino acids; Prostate secretory protein PSP94; PRPS; PRSP; PSP 57; PSP; PSP-94; PSP57; PSP94; Seminal plasma beta inhibin; Seminal plasma beta-inhibin;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P08118 MSMB_HUMAN:

Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder.

Description:
The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.
Sequence:
MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

PTMs - P08118 As Substrate

Site PTM Type Enzyme
T54 Phosphorylation

Research Backgrounds

Subcellular Location:

Secreted.
Note: Sperm surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder.

Subunit Structure:

Homodimer; Interacts with PI16.

Family&Domains:

Belongs to the beta-microseminoprotein family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.