Product: GPX4 Antibody
Catalog: DF6701
Description: Rabbit polyclonal antibody to GPX4
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Chicken
Mol.Wt.: 22kDa; 22kD(Calculated).
Uniprot: P36969
RRID: AB_2838663

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(90%), Bovine(100%), Chicken(80%)
Clonality:
Polyclonal
Specificity:
GPX4 Antibody detects endogenous levels of total GPX4.
RRID:
AB_2838663
Cite Format: Affinity Biosciences Cat# DF6701, RRID:AB_2838663.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Glutathione peroxidase 4; GPX 4; GPX-4; GPX4; GPX4_HUMAN; GSHPx-4; MCSP; mitochondrial; PHGPx; Phospholipid hydroperoxidase; Phospholipid hydroperoxide glutathione peroxidase; Phospholipid hydroperoxide glutathione peroxidase mitochondrial; snGPx; snPHGPx; Sperm nucleus glutathione peroxidase;

Immunogens

Immunogen:

A synthesized peptide derived from human GPX4, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P36969 GPX4_HUMAN:

Present primarily in testis.

Description:
Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified. [provided by RefSeq, Jul 2008]
Sequence:
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Pig
90
Chicken
80
Horse
0
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P36969 As Substrate

Site PTM Type Enzyme
S40 Phosphorylation
K47 Acetylation
K107 Ubiquitination
K162 Ubiquitination
K167 Ubiquitination

Research Backgrounds

Function:

Essential antioxidant peroxidase that directly reduces phospholipid hydroperoxide even if they are incorporated in membranes and lipoproteins (By similarity). Can also reduce fatty acid hydroperoxide, cholesterol hydroperoxide and thymine hydroperoxide (By similarity). Plays a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation (By similarity). Required to prevent cells from ferroptosis, a non-apoptotic cell death resulting from an iron-dependent accumulation of lipid reactive oxygen species. The presence of selenocysteine (Sec) versus Cys at the active site is essential for life: it provides resistance to overoxidation and prevents cells against ferroptosis (By similarity). The presence of Sec at the active site is also essential for the survival of a specific type of parvalbumin-positive interneurons, thereby preventing against fatal epileptic seizures (By similarity). May be required to protect cells from the toxicity of ingested lipid hydroperoxides (By similarity). Required for normal sperm development and male fertility (By similarity). Essential for maturation and survival of photoreceptor cells (By similarity). Plays a role in a primary T-cell response to viral and parasitic infection by protecting T-cells from ferroptosis and by supporting T-cell expansion (By similarity).

Subcellular Location:

Mitochondrion.

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Present primarily in testis.

Subunit Structure:

Monomer. Has a tendency to form higher mass oligomers.

Family&Domains:

Belongs to the glutathione peroxidase family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Metabolism > Metabolism of other amino acids > Glutathione metabolism.

References

1). Cell Membrane Camouflaged Metal Oxide–Black Phosphorus Biomimetic Nanocomplex Enhances Photo-chemo-dynamic Ferroptosis. ACS Applied Materials & Interfaces, 2022 (PubMed: 35658416) [IF=9.5]

2). Microbial metabolite deoxycholic acid-mediated ferroptosis exacerbates high-fat diet-induced colonic inflammation. Molecular metabolism, 2024 (PubMed: 38642891) [IF=8.1]

Application: IHC    Species: Mouse    Sample: colonic tissues

Figure 3 Deoxycholic acid enhanced lipopolysaccharide-induced ferroptosis in intestinal epithelial cells (A–H) IEC-6 cells and Caco-2 cells were incubated with or without 10 ng/mL LPS for 12 h, followed by 200 μM DCA for 2 h. They were divided into four group (n = 6 in each group): control group, DCA group, LPS group and LPS + DCA group. (A) The relative mRNA expression level of GPX4 in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (B) The relative mRNA expression level of ACSL4 in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (C) The protein level of GPX4, ACSL4 and β-actin in each group of IEC-6 cells and Caco-2 cells. (D) Representative transmission electron microscopy images (scale bars, 1 μm) of cell and mitochondria, and Fe2+/Hoechst immunofluorescence in each group of IEC-6 cells. Mitochondria was showed by white arrows in the pictures. The red fluorescence is indicative of the presence of ferrous ions. (E) The content of Fe2+ in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (F) The content of GSH in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (G) The content of ROS in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (H) The content of MDA in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (I-K) IEC-6 cells were incubated 2 μM ferrostatin-1 (Fer-1) for 16 h, and then incubated with or without 10 ng/mL LPS for 12 h, followed by 200 μM DCA for 2 h. They were divided into six group (n = 5 or 6 in each group): control group, LPS group, LPS + DCA group, Fer-1 group, LPS + Fer-1 group and LPS + DCA + Fer-1 group. (I) The relative mRNA expression level of GPX4, ACSL4 and DMT1 in each group of IEC-6 cells (n = 6 in each group). (J) The content of GSH in each group of IEC-6 cells (n = 5 in each group). (K) The content of MDA in each group of IEC-6 cells (n = 5 in each group). Data are represented as mean ± SEM. ns P > 0.05, ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001, ∗∗∗∗P < 0.0001. ##P < 0.01, ####P < 0.0001. ∗ LPS group vs control group, LPS + DCA group vs LPS group. # LPS + Fer-1 group vs LPS group, LPS + DCA + Fer-1 group vs LPS + DCA group.

Application: WB    Species: Rat and Human    Sample: IEC-6 cells and Caco-2 cells

Figure 3 Deoxycholic acid enhanced lipopolysaccharide-induced ferroptosis in intestinal epithelial cells (A–H) IEC-6 cells and Caco-2 cells were incubated with or without 10 ng/mL LPS for 12 h, followed by 200 μM DCA for 2 h. They were divided into four group (n = 6 in each group): control group, DCA group, LPS group and LPS + DCA group. (A) The relative mRNA expression level of GPX4 in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (B) The relative mRNA expression level of ACSL4 in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (C) The protein level of GPX4, ACSL4 and β-actin in each group of IEC-6 cells and Caco-2 cells. (D) Representative transmission electron microscopy images (scale bars, 1 μm) of cell and mitochondria, and Fe2+/Hoechst immunofluorescence in each group of IEC-6 cells. Mitochondria was showed by white arrows in the pictures. The red fluorescence is indicative of the presence of ferrous ions. (E) The content of Fe2+ in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (F) The content of GSH in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (G) The content of ROS in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (H) The content of MDA in each group of IEC-6 cells and Caco-2 cells (n = 6 in each group). (I-K) IEC-6 cells were incubated 2 μM ferrostatin-1 (Fer-1) for 16 h, and then incubated with or without 10 ng/mL LPS for 12 h, followed by 200 μM DCA for 2 h. They were divided into six group (n = 5 or 6 in each group): control group, LPS group, LPS + DCA group, Fer-1 group, LPS + Fer-1 group and LPS + DCA + Fer-1 group. (I) The relative mRNA expression level of GPX4, ACSL4 and DMT1 in each group of IEC-6 cells (n = 6 in each group). (J) The content of GSH in each group of IEC-6 cells (n = 5 in each group). (K) The content of MDA in each group of IEC-6 cells (n = 5 in each group). Data are represented as mean ± SEM. ns P > 0.05, ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001, ∗∗∗∗P < 0.0001. ##P < 0.01, ####P < 0.0001. ∗ LPS group vs control group, LPS + DCA group vs LPS group. # LPS + Fer-1 group vs LPS group, LPS + DCA + Fer-1 group vs LPS + DCA group.

3). Biochanin A protects against iron overload associated knee osteoarthritis via regulating iron levels and NRF2/System xc-/GPX4 axis. Biomedicine & Pharmacotherapy, 2023 (PubMed: 36379122) [IF=7.5]

4). GSK-3β-dependent Nrf2 antioxidant response modulates ferroptosis of lens epithelial cells in age-related cataract. Free Radical Biology and Medicine, 2023 (PubMed: 37156294) [IF=7.4]

5). Cigarette smoke induces the ROS accumulation and iNOS activation through deactivation of Nrf-2/SIRT3 axis to mediate the human bronchial epithelium ferroptosis. Free Radical Biology and Medicine, 2023 (PubMed: 36871899) [IF=7.4]

6). YAP1 alleviates sepsis-induced acute lung injury via inhibiting ferritinophagy-mediated ferroptosis. Frontiers in Immunology, 2022 (PubMed: 35979359) [IF=7.3]

7). Astragaloside IV attenuates myocardial dysfunction in diabetic cardiomyopathy rats through downregulation of CD36-mediated ferroptosis. Phytotherapy Research, 2023 (PubMed: 36882189) [IF=7.2]

8). Ferroptosis, a new target for treatment of renal injury and fibrosis in a 5/6 nephrectomy-induced CKD rat model. Cell Death Discovery, 2022 (PubMed: 35318301) [IF=7.0]

Application: WB    Species: Rat    Sample:

Fig. 2 Typical features of ferroptosis present in CKD rats. Biochemical trends (a–f) and pathological evidence (g–j) of ferroptosis in CKD rats. Green arrow, normal mitochondria; red arrow, MOM rupture; blue arrow, reduction or loss of MC; yellow arrow, MC swelling. **P < 0.01, ***P < 0.001 vs. Sham group; #P < 0.05, ##P < 0.01, ###P < 0.001 vs. CKD group. Scale bar in (a) = 50 μm. Scale bar in (f) = 500 μm.

Application: IF/ICC    Species: Rat    Sample:

Fig. 2 Typical features of ferroptosis present in CKD rats. Biochemical trends (a–f) and pathological evidence (g–j) of ferroptosis in CKD rats. Green arrow, normal mitochondria; red arrow, MOM rupture; blue arrow, reduction or loss of MC; yellow arrow, MC swelling. **P < 0.01, ***P < 0.001 vs. Sham group; #P < 0.05, ##P < 0.01, ###P < 0.001 vs. CKD group. Scale bar in (a) = 50 μm. Scale bar in (f) = 500 μm.

9). Chlorogenic Acid Alleviates Chronic Stress-Induced Duodenal Ferroptosis via the Inhibition of the IL-6/JAK2/STAT3 Signaling Pathway in Rats. Journal of Agricultural and Food Chemistry, 2022 (PubMed: 35380825) [IF=6.1]

10). Chlorogenic acid alleviates hypoxic-ischemic brain injury in neonatal mice. Neural Regeneration Research, 2023 (PubMed: 36018179) [IF=6.1]

Application: WB    Species: Mouse    Sample: brain tissues

Figure 4 CGA improves hypoxic-ischemic brain damage by reducing oxidative stress.(A) The MDA level in brain tissues. (B, C) Western blot of 4-HNE and GPX4 in brain tissues. β-Actin was used as an internal reference. (D, E) Quantitative analyses of 4-HNE and GPX4 (normalized to β-actin). Data are presented as mean ± SEM (n = 4). **P < 0.01, vs. Sham + NS group; #P < 0.05, ##P < 0.01, vs. HI + NS group (one-way analysis of variance followed by Tukey’s post hoc test). 4-HNE: 4-Hydroxynonenal; CGA: chlorogenic acid; GPX4: glutathione peroxidase 4; HI: hypoxic-ischemic brain injury; MDA: malondialdehyde; NS: normal saline.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.