CXCL7/PBP Antibody - #DF6695
![](/images/pubmed.gif)
Product: | CXCL7/PBP Antibody |
Catalog: | DF6695 |
Description: | Rabbit polyclonal antibody to CXCL7/PBP |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 14kDa; 14kD(Calculated). |
Uniprot: | P02775 |
RRID: | AB_2838657 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6695, RRID:AB_2838657.
Fold/Unfold
B TG1; Beta TG; Beta thromboglobulin; Beta-TG; C-X-C motif chemokine 7; Chemokine (C X C motif) ligand 7; Connective tissue activating peptide III; CTAP 3; CTAP III; CTAP-III; CTAP-III(1-81); CTAP3; CTAPIII; CXC chemokine ligand 7; CXCL 7; CXCL7; CXCL7_HUMAN; LA PF 4; LA-PF4; LDGF; Leukocyte derived growth factor; Leukocyte-derived growth factor; Low-affinity platelet factor IV; Macrophage-derived growth factor; MDGF; NAP 2; NAP-2; NAP-2(1-63); NAP-2(1-66); NAP-2(73); NAP-2(74); Neutrophil activating peptide 2; Neutrophil-activating peptide 2(1-63); PBP; Platelet basic protein; PPBP; Pro platelet basic protein (chemokine (C-X-C motif) ligand 7); Pro platelet basic protein; SCYB7; Small inducible cytokine subfamily B member 7; Small-inducible cytokine B7; TC1; TC2; TGB; TGB1; THBGB; THBGB1; Thrombocidin 1; Thrombocidin 2; Thromboglobulin, beta-1;
Immunogens
- P02775 CXCL7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
PTMs - P02775 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S52 | Phosphorylation | Uniprot | |
Y58 | Phosphorylation | Uniprot |
Research Backgrounds
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
Proteolytic removal of residues 1-9 produces the active peptide connective tissue-activating peptide III (CTAP-III) (low-affinity platelet factor IV (LA-PF4)).
Proteolytic removal of residues 1-13 produces the active peptide beta-thromboglobulin, which is released from platelets along with platelet factor 4 and platelet-derived growth factor.
NAP-2(1-66) is produced by proteolytical processing, probably after secretion by leukocytes other than neutrophils.
NAP-2(73) and NAP-2(74) seem not be produced by proteolytical processing of secreted precursors but are released in an active form from platelets.
Secreted.
Beta-thromboglobulin is a homotetramer.
Belongs to the intercrine alpha (chemokine CxC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
References
Application: WB Species: Human Sample: colon cancer cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.