Peroxiredoxin 2 Antibody - #DF6691

(1)   (11)  
Product: Peroxiredoxin 2 Antibody
Catalog: DF6691
Description: Rabbit polyclonal antibody to Peroxiredoxin 2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Dog, Xenopus
Mol.Wt.: 22kDa; 22kD(Calculated).
Uniprot: P32119
RRID: AB_2838653

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(100%), Sheep(100%), Dog(100%), Xenopus(82%)
Clonality:
Polyclonal
Specificity:
Peroxiredoxin 2 Antibody detects endogenous levels of total Peroxiredoxin 2.
RRID:
AB_2838653
Cite Format: Affinity Biosciences Cat# DF6691, RRID:AB_2838653.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Epididymis secretory sperm binding protein Li 2a; HEL S 2a; MGC4104; Natural killer cell enhancing factor B; Natural killer cell-enhancing factor B; Natural Killer Enhancing Factor B; NKEF B; NKEF-B; NKEFB; Peroxiredoxin-2; PRDX 2; PRDX2; PRDX2_HUMAN; PrP; PRX2; PRXII; PTX1; TDPX1; Thiol Specific Antioxidant 1; Thiol specific antioxidant protein; Thiol-specific antioxidant protein; Thioredoxin Dependent Peroxide Reductase 1; Thioredoxin peroxidase 1; Thioredoxin-dependent peroxide reductase 1; Torin; TPX1; TSA;

Immunogens

Immunogen:
Uniprot:

P32119(PRDX2_HUMAN) >>Visit HPA database.

Gene(ID):
PRDX2(7001)
Description:
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Sequence:
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
82
Zebrafish
58
Pig
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P32119 As Substrate

Site PTM Type Enzyme
A2 Acetylation
S3 Phosphorylation
K10 Ubiquitination
K16 Acetylation
K16 Ubiquitination
T18 O-Glycosylation
T18 Phosphorylation
K26 Acetylation
K26 Ubiquitination
K29 Ubiquitination
S31 Phosphorylation
K34 Acetylation
T89 Phosphorylation
K92 Ubiquitination
R110 Methylation
S112 O-Glycosylation
S112 Phosphorylation
Y115 Phosphorylation
K119 Acetylation
K119 Ubiquitination
T120 Phosphorylation
Y126 Phosphorylation
R127 Methylation
K135 Acetylation
K135 Ubiquitination
T142 Phosphorylation
R150 Methylation
S151 Phosphorylation
R157 Methylation
K177 Methylation
K177 Ubiquitination
T182 Phosphorylation
S190 Phosphorylation
K191 Sumoylation
K191 Ubiquitination
Y193 Phosphorylation
S195 Phosphorylation

Research Backgrounds

Function:

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).

PTMs:

The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) instead of its condensation to a disulfide bond. It can be reactivated by forming a transient disulfide bond with sulfiredoxin SRXN1, which reduces the cysteine sulfinic acid in an ATP- and Mg-dependent manner.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer; disulfide-linked, upon oxidation. 5 homodimers assemble to form a ring-like decamer. Interacts with TIPIN.

Family&Domains:

Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.

References

1). Proteomics changes after negative pressure wound therapy in diabetic foot ulcers. Molecular Medicine Reports (PubMed: 34608502) [IF=3.4]

Application: WB    Species: Human    Sample: Wound granulation tissues

Figure 4. Validation of the protein expression levels of CTSS, PROS1, ITIH4 and PRDX2. Wound granulation tissues from eight patients with diabetic foot ulcers before and after NPWT were collected and subjected to western blotting. Primary antibodies against (A) CTSS, (B) PROS1, (C) ITIH4 and (D) PRDX2 were used to detect differences in protein levels. (A1-D1) Protein bands from four representative patients prior to NPWT (designated as minus symbol ‘−’) and following NPWT (designated as plus symbol ‘+’) are presented in the left panel. Protein samples from the same patients were loaded next to each other. (A2-D2) Then, eight pairs of protein samples from eight patients were analyzed by ImageJ and are depicted as paired dots in the right panel. (A3-D3) The gray level of the target protein was compared with the internal reference (β-actin) gray level to obtain the relative expression value. Paired t-tests were performed and significant changes are indicated by ***P<0.001 vs. before NPWT. CTSS, cathepsin; PROS1, protein S isoform 1; ITIH4, inter α-trypsin inhibitor heavy chain H4; PRDX2, peroxiredoxin-2; NPWT, negative-pressure wound therapy.

Application: WB    Species: Human    Sample: Wound granulation tissues

Figure 4. Validation of the protein expression levels of CTSS, PROS1, ITIH4 and PRDX2. Wound granulation tissues from eight patients with diabetic foot ulcers before and after NPWT were collected and subjected to western blotting. Primary antibodies against (A) CTSS, (B) PROS1, (C) ITIH4 and (D) PRDX2 were used to detect differences in protein levels. (A1-D1) Protein bands from four representative patients prior to NPWT (designated as minus symbol ‘−’) and following NPWT (designated as plus symbol ‘+’) are presented in the left panel. Protein samples from the same patients were loaded next to each other. (A2-D2) Then, eight pairs of protein samples from eight patients were analyzed by ImageJ and are depicted as paired dots in the right panel. (A3-D3) The gray level of the target protein was compared with the internal reference (β-actin) gray level to obtain the relative expression value. Paired t-tests were performed and significant changes are indicated by ***P<0.001 vs. before NPWT. CTSS, cathepsin; PROS1, protein S isoform 1; ITIH4, inter α-trypsin inhibitor heavy chain H4; PRDX2, peroxiredoxin-2; NPWT, negative-pressure wound therapy.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.