CCL21 Antibody | Affinity Biosciences

1/1

Western blot analysis of extracts from C6, using CCL21 Antibody.

Product:	CCL21 Antibody
Catalog:	DF6681
Description:	Rabbit polyclonal antibody to CCL21
Application:	WB IHC
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	15kDa; 15kD(Calculated).
Uniprot:	O00585
RRID:	AB_2838643

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

CCL21 Antibody detects endogenous levels of total CCL21.

RRID:

AB_2838643
Cite Format: Affinity Biosciences Cat# DF6681, RRID:AB_2838643.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

6Ckine; Beta-chemokine exodus-2; C C motif chemokine ligand 21; C-C motif chemokine 21; CCL21; CCL21_HUMAN; Chemokine (C-C motif) ligand 21; Chemokine CC motif ligand 21; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; SCYA21; Secondary lymphoid-tissue chemokine; SLC; Small inducible cytokine A21; Small inducible cytokine subfamily A (Cys-Cys), member 21; Small-inducible cytokine A21; TCA4; UNQ784/PRO1600;

Immunogens

Immunogen:

Uniprot:

O00585(CCL21_HUMAN) >>Visit HPA database.

Gene(ID):

CCL21(6366)

Expression:

O00585 CCL21_HUMAN:

Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.

Description:

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19).

Sequence:

O00585 CCL21_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

PTMs - O00585 As Substrate

O00585

Site	PTM Type	Source
K114	Acetylation	Uniprot
K115	Acetylation	Uniprot
K115	Methylation	Uniprot
K117	Acetylation	Uniprot
K117	Methylation	Uniprot
K120	Acetylation	Uniprot
K120	Methylation	Uniprot
K123	Methylation	Uniprot

Research Backgrounds

O00585_CCL21_HUMAN

Function:

Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Subcellular Location:

Secreted.

Tissue Specificity:

Subunit Structure:

Monomer. Binds to CCR7. Interacts with PDPN; relocalizes PDPN to the basolateral membrane.

Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

CCL21 Antibody - #DF6681