POLR2D Antibody - #DF6664
Product: | POLR2D Antibody |
Catalog: | DF6664 |
Description: | Rabbit polyclonal antibody to POLR2D |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 16kDa; 16kD(Calculated). |
Uniprot: | O15514 |
RRID: | AB_2838626 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6664, RRID:AB_2838626.
Fold/Unfold
DNA directed RNA polymerase II 16 kDa polypeptide; DNA directed RNA polymerase II subunit D; DNA directed RNA polymerase II subunit RPB4; DNA-directed RNA polymerase II 16 kDa polypeptide; DNA-directed RNA polymerase II subunit D; DNA-directed RNA polymerase II subunit rpb4; HSRBP4; HSRPB4; polr2d; polymerase RNA II DNA directed polypeptide D; RBP4; RNA polymerase II 16 kDa subunit; RNA polymerase II subunit B4; RNA polymerase II subunit D; RNA polymerase II subunit hsRBP4; RPB16; RPB4_HUMAN;
Immunogens
- O15514 RPB4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O15514 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y67 | Phosphorylation | Uniprot | |
K112 | Ubiquitination | Uniprot | |
K137 | Ubiquitination | Uniprot |
Research Backgrounds
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double-stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA (By similarity).
Nucleus.
Component of the RNA polymerase II (Pol II) complex consisting of 12 subunits. RPB4 and RPB7 form a subcomplex that protrudes from the 10-subunit Pol II core complex.
Belongs to the eukaryotic RPB4 RNA polymerase subunit family.
Research Fields
· Genetic Information Processing > Transcription > RNA polymerase.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.