FCER2 Antibody | Affinity Biosciences

WB
IF/ICC
Cites

1/3

Western blot analysis of extracts from MCF7, using FCER2 Antibody.

Product:	FCER2 Antibody
Catalog:	DF6650
Description:	Rabbit polyclonal antibody to FCER2
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	36kDa, 50 kDa; 36kD(Calculated).
Uniprot:	P06734
RRID:	AB_2838612

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

FCER2 Antibody detects endogenous levels of total FCER2.

RRID:

AB_2838612
Cite Format: Affinity Biosciences Cat# DF6650, RRID:AB_2838612.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Blast 2; BLAST-2; Blast2; C type lectin domain family 4 member J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; CD 23; CD 23A; CD23; CD23 antigen; CD23A; CLEC 4J; CLEC4J; Fc epsilon receptor II; Fc epsilon RII; Fc fragment of IgE low affinity II receptor for; Fc fragment of IgE receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); Fc of IgE, low affinity II, receptor for (CD23); Fc receptor IgE low affinity II alpha polypeptide; Fc receptor, IgE, low affinity II, alpha polypeptide, isoform CRA_a; Fc-epsilon-RII; FCE 2; FCE2; FCER 2; Fcer2; FCER2_HUMAN; FCER2A; FceRII; IgE binding factor; IgE receptor lymphocyte; IgE-binding factor; IGEBF; Immunoglobulin E binding factor; Immunoglobulin E receptor, low affinity II; Immunoglobulin E-binding factor; Immunoglobulin epsilon chain; LEUKOCYTE ANTIGEN CD23; Low Affinity IgE Receptor; Low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; Ly-42; Ly42; Lymphocyte antigen CD23; Lymphocyte IgE receptor; MGC93219;

Immunogens

Immunogen:

Uniprot:

P06734(FCER2_HUMAN) >>Visit HPA database.

Gene(ID):

FCER2(2208)

Description:

The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

Sequence:

P06734 FCER2_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

PTMs - P06734 As Substrate

P06734

Site	PTM Type	Source
S254	Phosphorylation	Uniprot
S265	Phosphorylation	Uniprot
T314	Phosphorylation	Uniprot

Research Backgrounds

P06734_FCER2_HUMAN

Function:

Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).

PTMs:

N- and O-glycosylated.

The secreted form sCD23 is produced by ADAM10-mediated ectodomain shedding.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein. Cell membrane>Lipid-anchor. Secreted.
Note: Also exists as a soluble excreted form, sCD23.

Subunit Structure:

Homotrimer.

Research Fields

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)

References

1). Characterization of immune microenvironment in patients with HPV-positive and negative head and neck cancer. Scientific data, 2023 (PubMed: 37828063) [IF=9.8]

Application: IF/ICC Species: Human Sample:

Fig. 6 The in vitro study reveals that FCER2+ B cells inhibit the proliferation and migration ability of HPV+ tumors. (a) Flow cytometry analysis of B cells, plasma cells, macrophages, and FCER2+ B cells from PBMCs of patients with HNSCC. (b) Representative histopathological staining and HPV-p16, as well as FCER2 immunofluorescent staining images of HNSCC samples. FCER2+ B cells are cocultured with HPV+ SCC090 cells. (c) Scratch experiment showing cell migration. (d) Transwell chamber invasion assay showing cell invasion. (e) CCK-8 experiment showing cell proliferation. Figure 6 represents three experiments that achieved similar results. *p

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

FCER2 Antibody - #DF6650