ICOS Antibody - #DF6631
Product: | ICOS Antibody |
Catalog: | DF6631 |
Description: | Rabbit polyclonal antibody to ICOS |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 23kDa; 23kD(Calculated). |
Uniprot: | Q9Y6W8 |
RRID: | AB_2838593 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6631, RRID:AB_2838593.
Fold/Unfold
Activation inducible lymphocyte immunomediatory molecule; Activation-inducible lymphocyte immunomediatory molecule; AILIM; CD278; CD278 antigen; CD28-related Protein-1; CRP1; CVID1; ICOS; ICOS_HUMAN; Inducible costimulator; Inducible T cell co stimulator; Inducible T-cell costimulator; MGC39850;
Immunogens
Activated T-cells. Highly expressed on tonsillar T-cells, which are closely associated with B-cells in the apical light zone of germinal centers, the site of terminal B-cell maturation. Expressed at lower levels in thymus, lung, lymph node and peripheral blood leukocytes. Expressed in the medulla of fetal and newborn thymus.
- Q9Y6W8 ICOS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
PTMs - Q9Y6W8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S71 | Phosphorylation | Uniprot | |
Y180 | Phosphorylation | Uniprot |
Research Backgrounds
Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes (By similarity).
N-glycosylated.
Cell membrane>Single-pass type I membrane protein.
Secreted.
Activated T-cells. Highly expressed on tonsillar T-cells, which are closely associated with B-cells in the apical light zone of germinal centers, the site of terminal B-cell maturation. Expressed at lower levels in thymus, lung, lymph node and peripheral blood leukocytes. Expressed in the medulla of fetal and newborn thymus.
Homodimer; disulfide-linked.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Immune diseases > Primary immunodeficiency.
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.