GADD45A Antibody - #DF6622
Product: | GADD45A Antibody |
Catalog: | DF6622 |
Description: | Rabbit polyclonal antibody to GADD45A |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 18kDa; 18kD(Calculated). |
Uniprot: | P24522 |
RRID: | AB_2838584 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6622, RRID:AB_2838584.
Fold/Unfold
DDIT 1; DDIT-1; DDIT1; DNA damage inducible transcript 1; DNA damage-inducible transcript 1 protein; GA45A_HUMAN; GADD45; GADD45A; Growth arrest and DNA damage inducible 45 alpha; Growth arrest and DNA damage inducible alpha; Growth arrest and DNA damage-inducible protein GADD45 alpha;
Immunogens
- P24522 GA45A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P24522 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T2 | Phosphorylation | Uniprot | |
K12 | Sumoylation | Uniprot | |
K12 | Ubiquitination | Uniprot | |
K18 | Ubiquitination | Uniprot | |
K29 | Ubiquitination | Uniprot | |
S32 | Phosphorylation | Uniprot | |
Y41 | Phosphorylation | Uniprot |
Research Backgrounds
In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.
Nucleus.
Interacts with MAPK14 (By similarity). Predominantly monomeric but also forms dimers and other oligomers as concentration increases. Interacts with GADD45GIP1. Interacts weakly with PCNA. Interacts with AURKA, likely to compete with dimerization.
Belongs to the GADD45 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Specific types > Colorectal cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Endometrial cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Glioma. (View pathway)
· Human Diseases > Cancers: Specific types > Thyroid cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Basal cell carcinoma. (View pathway)
· Human Diseases > Cancers: Specific types > Melanoma. (View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia. (View pathway)
· Human Diseases > Cancers: Specific types > Small cell lung cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Breast cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.