AKR1C3 Antibody - #DF6613

(6)  
Product: AKR1C3 Antibody
Catalog: DF6613
Description: Rabbit polyclonal antibody to AKR1C3
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 37kDa; 37kD(Calculated).
Uniprot: P42330
RRID: AB_2838575

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
AKR1C3 Antibody detects endogenous levels of total AKR1C3.
RRID:
AB_2838575
Cite Format: Affinity Biosciences Cat# DF6613, RRID:AB_2838575.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

17 beta HSD 5; 17 beta hydroxysteroid dehydrogenase type 5; 17-beta-HSD 5; 17-beta-hydroxysteroid dehydrogenase type 5; 2-dihydrobenzene-1; 2-diol dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; 3 alpha hydroxysteroid dehydrogenase type II; 3-alpha-HSD type 2; 3-alpha-HSD type II; 3-alpha-HSD type II, brain; 3-alpha-hydroxysteroid dehydrogenase type 2; AK1C3_HUMAN; AKR1 C3; Akr1c18; AKR1C3; Aldo keto reductase family 1 member C3; Aldo-keto reductase family 1 member C3; brain; Chlordecone reductase; Chlordecone reductase homolog HAKRb; DD-3; DD3; DDH1; DDX; Dihydrodiol dehydrogenase 3; Dihydrodiol dehydrogenase type I; Dihydrodiol dehydrogenase X; HA1753; HAKRB; HAKRe; hluPGFS; HSD17B5; Indanol dehydrogenase; KIAA0119; PGFS; Prostaglandin F synthase; Testosterone 17-beta-dehydrogenase 5; Trans-1; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Type IIb 3 alpha hydroxysteroid dehydrogenase;

Immunogens

Immunogen:
Uniprot:

P42330(AK1C3_HUMAN) >>Visit HPA database.

Gene(ID):
AKR1C3(8644)
Expression:
P42330 AK1C3_HUMAN:

Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels in epithelial cells than in stromal cells. In the brain, expressed in medulla, spinal cord, frontotemporal lobes, thalamus, subthalamic nuclei and amygdala. Weaker expression in the hippocampus, substantia nigra and caudate.

Description:
AKR1C3(Aldo-keto reductase family 1 member C3) is also named as DDH1, HSD17B5, KIAA0119, PGFS and belongsi to AKR1C family. .In humans, at least four AKR1C isoforms exist: AKR1C1, AKR1C2, AKR1C3, AKR1C4 and AKR1C3 shares >86% sequence identity with these three highly related human AKRs(PMID:18574251). It catalyzes the conversion of aldehydes and ketones to alcohols and androgen, estrogen, PG, xenobiotics metabolism. The rat kidney possesses a dimeric form of 75 kDa(PMID:18574251).
Sequence:
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

PTMs - P42330 As Substrate

Site PTM Type Enzyme
K9 Sumoylation
Y24 Phosphorylation
K33 Ubiquitination
K39 Ubiquitination
S51 Phosphorylation
Y55 Phosphorylation
S67 Phosphorylation
K68 Ubiquitination
S73 Phosphorylation
K75 Acetylation
K75 Sumoylation
K75 Ubiquitination
Y81 Phosphorylation
T82 Phosphorylation
S83 Phosphorylation
K105 Acetylation
Y110 Phosphorylation
S118 Phosphorylation
S129 Phosphorylation
T147 Phosphorylation
K161 Ubiquitination
S162 Phosphorylation
S166 Phosphorylation
K179 Ubiquitination
K183 Ubiquitination
K185 Ubiquitination
Y196 Phosphorylation
K201 Ubiquitination
K207 Ubiquitination
S208 Phosphorylation
K209 Acetylation
K209 Ubiquitination
S232 Phosphorylation
K246 Acetylation
K246 Ubiquitination
K247 Acetylation
K247 Ubiquitination
K270 Acetylation
K270 Ubiquitination
Y272 Phosphorylation
Y305 Phosphorylation
Y319 Phosphorylation
S320 Phosphorylation
Y323 Phosphorylation

Research Backgrounds

Function:

Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels in epithelial cells than in stromal cells. In the brain, expressed in medulla, spinal cord, frontotemporal lobes, thalamus, subthalamic nuclei and amygdala. Weaker expression in the hippocampus, substantia nigra and caudate.

Family&Domains:

Belongs to the aldo/keto reductase family.

Research Fields

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Metabolism of cofactors and vitamins > Folate biosynthesis.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Endocrine system > Ovarian steroidogenesis.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.