Proteasome 20S LMP2 Antibody - #DF6606
Product: | Proteasome 20S LMP2 Antibody |
Catalog: | DF6606 |
Description: | Rabbit polyclonal antibody to Proteasome 20S LMP2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 23kDa; 23kD(Calculated). |
Uniprot: | P28065 |
RRID: | AB_2838568 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6606, RRID:AB_2838568.
Fold/Unfold
Beta1i; Large multifunctional peptidase 2; Large multifunctional protease 2; LMP 2; LMP2; Low molecular mass protein 2; Macropain chain 7; MGC70470; Multicatalytic endopeptidase complex chain 7; OTTHUMP00000062982; Proteasome (prosome macropain) subunit beta type 9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); Proteasome beta 9 subunit; Proteasome catalytic subunit 1i; Proteasome chain 7; Proteasome related gene 2; Proteasome subunit beta 6i; Proteasome subunit beta type 9; Proteasome subunit beta type-9; Proteasome subunit beta-1i; PSB9_HUMAN; PSMB 9; PSMB6i; PSMB9; Really interesting new gene 12 protein; RING 12; RING12; RING12 protein;
Immunogens
- P28065 PSB9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P28065 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
R3 | Methylation | Uniprot | |
T8 | Phosphorylation | Uniprot | |
K53 | Acetylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
S55 | Phosphorylation | Uniprot | |
K109 | Acetylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
S188 | Phosphorylation | Uniprot | |
K215 | Ubiquitination | Uniprot | |
Y217 | Phosphorylation | Uniprot |
Research Backgrounds
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.
Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.
Cytoplasm. Nucleus.
The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is composed of 28 subunits that are arranged in four stacked rings, resulting in a barrel-shaped structure. The two end rings are each formed by seven alpha subunits, and the two central rings are each formed by seven beta subunits. The catalytic chamber with the active sites is on the inside of the barrel. Component of the immunoproteasome, where it displaces the equivalent housekeeping subunit PSMB6. Component of the spermatoproteasome, a form of the proteasome specifically found in testis.
(Microbial infection) Interacts with HIV-1 TAT protein.
Belongs to the peptidase T1B family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Proteasome.
References
Application: WB Species: human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.