POLR2E Antibody - #DF6595
Product: | POLR2E Antibody |
Catalog: | DF6595 |
Description: | Rabbit polyclonal antibody to POLR2E |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 24kDa; 25kD(Calculated). |
Uniprot: | P19388 |
RRID: | AB_2838557 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6595, RRID:AB_2838557.
Fold/Unfold
and III subunit ABC1; and III subunit RPABC1; DNA directed RNA polymerase II 23 kda polypeptide; DNA directed RNA polymerase II 23 kDa polypeptide; DNA directed RNA polymerase II polypeptide E; DNA directed RNA polymerase II subunit E; DNA directed RNA polymerases I II and III subunit RPABC1; DNA-directed RNA polymerase II 23 kDa polypeptide; DNA-directed RNA polymerase II subunit E; DNA-directed RNA polymerases I; hRPB25; hsRPB5; II; Polr2e; Polymerase (RNA) II (DNA directed) polypeptide E (25kD); Polymerase (RNA) II (DNA directed) polypeptide E, 25kDa; RNA polymerases I; RNA polymerases I, II, and III subunit ABC1; RPAB1_HUMAN; RPABC1; RPB5; RPB5 homolog; XAP4;
Immunogens
- P19388 RPAB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P19388 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
R9 | Methylation | Uniprot | |
K15 | Ubiquitination | Uniprot | |
T29 | Phosphorylation | Uniprot | |
T56 | Phosphorylation | Uniprot | |
T59 | Phosphorylation | Uniprot | |
K81 | Ubiquitination | Uniprot | |
K85 | Ubiquitination | Uniprot | |
K88 | Ubiquitination | Uniprot | |
T111 | Phosphorylation | Uniprot | |
K115 | Ubiquitination | Uniprot | |
K186 | Ubiquitination | Uniprot | |
K192 | Ubiquitination | Uniprot |
Research Backgrounds
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2E/RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).
Nucleus.
Component of the RNA polymerase I (Pol I), RNA polymerase II (Pol II) and RNA polymerase III (Pol III) complexes consisting of at least 13, 12 and 17 subunits, respectively (By similarity). In RNA Pol II, this subunit is present in 2-fold molar excess over the other subunits. Interacts with URI1.
(Microbial infection) Interacts with HBV protein X.
Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.
Research Fields
· Genetic Information Processing > Transcription > RNA polymerase.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.