KPNA1 Antibody - #DF6587
Product: | KPNA1 Antibody |
Catalog: | DF6587 |
Description: | Rabbit polyclonal antibody to KPNA1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 60kDa; 60kD(Calculated). |
Uniprot: | P52294 |
RRID: | AB_2838549 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6587, RRID:AB_2838549.
Fold/Unfold
IMA5_HUMAN; Importin alpha 1 subunit; Importin alpha 5; Importin alpha S1; Importin subunit alpha-5, N-terminally processed; IPO A5; IPOA 5; IPOA5; Karyopherin alpha 1; Karyopherin alpha 1 subunit; Karyopherin subunit alpha-1; KPNA 1; KPNA1; mSRP 1; mSRP1; NPI 1; NPI-1; NPI1; Nucleoprotein interactor 1; RAG cohort protein 2; RCH 2; RCH2; Recombination activating gene cohort 2; SRP 1; SRP1 beta; SRP1-beta;
Immunogens
- P52294 IMA5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P52294 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T2 | Acetylation | Uniprot | |
T2 | Phosphorylation | Uniprot | |
T3 | Phosphorylation | Uniprot | |
K6 | Acetylation | Uniprot | |
K6 | Ubiquitination | Uniprot | |
S13 | Phosphorylation | Uniprot | |
S18 | Phosphorylation | O14757 (CHEK1) | Uniprot |
K46 | Ubiquitination | Uniprot | |
S63 | Phosphorylation | Uniprot | |
S95 | Phosphorylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K112 | Ubiquitination | Uniprot | |
T124 | Phosphorylation | Uniprot | |
K136 | Ubiquitination | Uniprot | |
K222 | Ubiquitination | Uniprot | |
S237 | Phosphorylation | Uniprot | |
S244 | Phosphorylation | Uniprot | |
K311 | Ubiquitination | Uniprot | |
K356 | Ubiquitination | Uniprot | |
T361 | Phosphorylation | Uniprot | |
S363 | Phosphorylation | Uniprot | |
T375 | Phosphorylation | Uniprot | |
T396 | Phosphorylation | Uniprot | |
K398 | Ubiquitination | Uniprot | |
S409 | Phosphorylation | Uniprot | |
K459 | Ubiquitination | Uniprot | |
Y476 | Phosphorylation | Uniprot | |
Y493 | Phosphorylation | Uniprot |
Research Backgrounds
Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
Polyubiquitinated in the presence of RAG1 (in vitro).
Cytoplasm. Nucleus.
Expressed ubiquitously.
Heterodimer; with KPNB1. Interacts with ANP32E (By similarity). Interacts with ZIC3 (By similarity). Interacts with NSMF; the interaction occurs in a calcium-independent manner after synaptic NMDA receptor stimulation and is required for nuclear import of NSMF but is competed by CABP1 (By similarity). Interacts with APEX1. Interacts with RAG1. Interacts with CTNNBL1 (via its N-terminal). Interacts with AICDA (via its NLS). Interacts with SNAI1 (via zinc fingers). Interacts with DCAF8. Interacts with ITSN1 isoform 2.
(Microbial infection) Interacts with human cytomegalovirus/HCMV UL84.
(Microbial infection) Interacts with HIV-1 Vpr.
(Microbial infection) Interacts with ebolavirus protein VP24.
(Microbial infection) Interacts with the venezuelan equine encephalitis virus protease nsP2; this interaction probably allows the active transport of protease nsP2 into the host nucleus.
Consists of an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. The N-terminal hydrophilic region contains the importin beta binding domain (IBB domain), which is sufficient for binding importin beta and essential for nuclear protein import.
The IBB domain is thought to act as an intrasteric autoregulatory sequence by interacting with the internal autoinhibitory NLS. Binding of KPNB1 probably overlaps the internal NLS and contributes to a high affinity for cytoplasmic NLS-containing cargo substrates. After dissociation of the importin/substrate complex in the nucleus the internal autohibitory NLS contributes to a low affinity for nuclear NLS-containing proteins (By similarity).
The major and minor NLS binding sites are mainly involved in recognition of simple or bipartite NLS motifs. Structurally located within in a helical surface groove they contain several conserved Trp and Asn residues of the corresponding third helices (H3) of ARM repeats which mainly contribute to binding (By similarity).
Belongs to the importin alpha family.
Research Fields
· Human Diseases > Infectious diseases: Viral > Influenza A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.