CD9 Antibody - #DF6565

(3)   (3)  
Product: CD9 Antibody
Catalog: DF6565
Description: Rabbit polyclonal antibody to CD9
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 25kDa; 25kD(Calculated).
Uniprot: P21926
RRID: AB_2838527

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(88%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(88%)
Clonality:
Polyclonal
Specificity:
CD9 Antibody detects endogenous levels of total CD9.
RRID:
AB_2838527
Cite Format: Affinity Biosciences Cat# DF6565, RRID:AB_2838527.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Tetraspanin 29; 5H9; 5H9 antigen; Antigen defined by monoclonal antibody 602 29; Antigen defined by monoclonal antibody 60229; BA-2/p24 antigen; BA2; BTCC 1; BTCC1; CD9; CD9 antigen; CD9 antigen p24; CD9 molecule; CD9_HUMAN; Cell growth inhibiting gene 2 protein; Cell growth-inhibiting gene 2 protein; DRAP 27; DRAP27; GIG2; Growth inhibiting gene 2 protein; Leukocyte antigen MIC3; MIC3; Motility related protein; Motility-related protein; MRP 1; MRP-1; MRP1; p24; p24 antigen; Tetraspanin-29; Tspan 29; Tspan-29; TSPAN29;

Immunogens

Immunogen:
Uniprot:

P21926(CD9_HUMAN) >>Visit HPA database.

Gene(ID):
CD9(928)
Expression:
P21926 CD9_HUMAN:

Detected in platelets (at protein level) (PubMed:19640571). Expressed by a variety of hematopoietic and epithelial cells (PubMed:19640571).

Description:
This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]
Sequence:
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Rabbit
100
Pig
88
Dog
88
Xenopus
63
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P21926 As Substrate

Site PTM Type Enzyme
Y125 Phosphorylation
K126 Methylation
K126 Ubiquitination
K131 Ubiquitination
K133 Ubiquitination
K135 Ubiquitination
K170 Ubiquitination
T175 Phosphorylation
T177 Phosphorylation
K179 Ubiquitination
K186 Ubiquitination

Research Backgrounds

Function:

Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion (By similarity). In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). Acts as a receptor for PSG17 (By similarity). Involved in platelet activation and aggregation. Regulates paranodal junction formation (By similarity). Involved in cell adhesion, cell motility and tumor metastasis.

PTMs:

Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro). The protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Membrane>Multi-pass membrane protein. Secreted>Extracellular exosome.
Note: Present at the cell surface of oocytes. Accumulates in the adhesion area between the sperm and egg following interaction between IZUMO1 and its receptor IZUMO1R/JUNO.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in platelets (at protein level). Expressed by a variety of hematopoietic and epithelial cells.

Subunit Structure:

Forms both disulfide-linked homodimers and higher homooligomers as well as heterooligomers with other members of the tetraspanin family. Interacts (via the second extracellular domain) with integrin ITGAV:ITGB3. Interacts with integrin ITGA6:ITGB1; interaction takes place in oocytes and is involved in sperm-egg fusion (By similarity). Part of integrin-tetraspanin complexes composed of CD81, beta-1 and beta-2 integrins in the membrane of monocyte/macrophages. Interacts with CD63; identified in a complex with CD63 and ITGB3. Associates with CR2/CD21 and with PTGFRN/CD9P1. Part of a complex composed of CD9, CD81, PTGFRN and IGSF8 (By similarity). Interacts directly with IGSF8. Interacts with PDPN; this interaction is homophilic and attenuates platelet aggregation and pulmonary metastasis induced by PDPN. Interacts (on T cell side) with CD81 at immunological synapses between antigen-presenting cells and T cells.

Family&Domains:

Belongs to the tetraspanin (TM4SF) family.

Research Fields

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

References

1). Extracellular vesicles delivering nuclear factor I/C for hard tissue engineering: Treatment of apical periodontitis and dentin regeneration. Journal of Tissue Engineering, 2022 (PubMed: 35321254) [IF=6.7]

Application: WB    Species: Human    Sample: SCAPs

Figure 2. Identification of EVs derived from LPS-stimulated DPCs (LPS-EVs) and establishment of in vitro model. (a) CCK8 assay detected cell viability of DPCs treated LPS (0.1, 1, 10, 100 µg/mL). (b) 1 µg/mL LPS increased EVs secretion of DPCs, compared to the other groups. (c) Schematic diagram shows the four types EV collected from EV-free culture medium of DPCs with or without LPS stimulation (0.1, 1, 10 µg/mL), which were used in subsequent assays. (d) Nanoparticle tracing assay (NTA) revealed the diameter of collected EVs was approximately 100 nm. (e) Scanning electron microscopy (SEM) of cup and saucer-shaped EVs. (f) Immunofluorescence staining confirmed that PKH26-labeled EVs (red) were endocytosed by SCAPs. DAPI (blue), and F-actin (green). (g) Western blot analysis of EVs surface markers (CD9, CD63, CD81 and TSG101). (h) CCK8 assay detected the effect of Nor-EV and LPS-EVs on cell viability of SCAPs. *p < 0.05. **p < 0.01. ***p < 0.001.#p < 0.0001.

Application: WB    Species: rat    Sample:

Figure 2. | Identification of EVs derived from LPS-stimulated DPCs (LPS-EVs) and establishment of in vitro model.(g) Western blot analysis of EVs surface markers (CD9, CD63, CD81 and TSG101).
2). Chemerin-Induced Down-Regulation of Placenta-Derived Exosomal miR-140-3p and miR-574-3p Promotes Umbilical Vein Endothelial Cells Proliferation, Migration, and Tube Formation in Gestational Diabetes Mellitus. Cells, 2022 (PubMed: 36359855) [IF=6.0]
3). Extracellular vesicles of human glial cells exert neuroprotective effects via brain miRNA modulation in a rat model of traumatic brain injury. Scientific reports, 2023 (PubMed: 37989873) [IF=3.8]

Application: WB    Species: Human    Sample:

Figure 2 Characterization of extracellular vesicles released by human GPCs obtained from three independent donors. (A) Transmission electron microscopy images and size distribution charts for three isolates (co-plotted with the non-conditioned medium control data, blank). (B) Representative immunoblots showing the presence of tetraspanins CD81, CD9, and CD63 in three samples.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.