| Product: | p18 INK4c Antibody |
| Catalog: | AF0620 |
| Description: | Rabbit polyclonal antibody to p18 INK4c |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IHC, IF/ICC |
| Reactivity: | Human, Mouse, Monkey |
| Prediction: | Pig, Bovine, Sheep, Dog |
| Mol.Wt.: | 18kDa(Observed); 18kD(Calculated). |
| Uniprot: | P42773 |
| RRID: | AB_2833794 |
Control Products
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0620, RRID:AB_2833794.
Fold/Unfold
CDK6 inhibitor p18; CDKN 2C; CDKN 6; Cdkn2c; CDKN6; CDN2C_HUMAN; Cyclin dependent inhibitor; Cyclin dependent kinase 4 inhibitor C; Cyclin dependent kinase 6 inhibitor; Cyclin dependent kinase 6 inhibitor p18; Cyclin dependent kinase inhibitor 2C (p18 inhibits CDK4); Cyclin dependent kinase inhibitor 2C; Cyclin-dependent kinase 4 inhibitor C; Cyclin-dependent kinase 6 inhibitor; INK4C; OTTHUMP00000046546; p18; p18 inhibits CDK4; p18 INK4c; p18 INK6; p18-INK4c; p18-INK6;
Immunogens
A synthesized peptide derived from human p18 INK4c, corresponding to a region within C-terminal amino acids.
- P42773 CDN2C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.
Highest levels found in skeletal muscle. Also found in pancreas and heart.
Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
References
Application: IF/ICC Species: Human Sample: NP tissue
Application: IHC Species: Human Sample: NP tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.