Product: CD59 Antibody
Catalog: DF6557
Description: Rabbit polyclonal antibody to CD59
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human
Mol.Wt.: 19kDa; 14kD(Calculated).
Uniprot: P13987
RRID: AB_2838519

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
CD59 Antibody detects endogenous levels of total CD59.
RRID:
AB_2838519
Cite Format: Affinity Biosciences Cat# DF6557, RRID:AB_2838519.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

16.3A5; 1F5; 1F5 antigen; 20 kDa homologous restriction factor; CD 59; CD_antigen=CD59; CD59; CD59 antigen; CD59 antigen complement regulatory protein; CD59 antigen p18 20; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); CD59 glycoprotein; CD59 molecule; CD59 molecule complement regulatory protein; CD59_HUMAN; Cd59a; Complement regulatory protein; EJ16; EJ30; EL32; FLJ38134; FLJ92039; G344; HRF 20; HRF-20; HRF20; Human leukocyte antigen MIC11; Ly 6 like protein; Lymphocytic antigen CD59/MEM43; MAC inhibitory protein; MAC IP; MAC-inhibitory protein; MAC-IP; MACIF; MACIP; MEM43; MEM43 antigen; Membrane attack complex (MAC) inhibition factor; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MGC2354; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18 20; Protectin; Surface antigen recognized by monoclonal antibody 16.3A5; T cell activating protein;

Immunogens

Immunogen:

A synthesized peptide derived from human CD59, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
Sequence:
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

Research Backgrounds

Function:

Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.

The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.

PTMs:

N- and O-glycosylated. The N-glycosylation mainly consists of a family of biantennary complex-type structures with and without lactosamine extensions and outer arm fucose residues. Also significant amounts of triantennary complexes (22%). Variable sialylation also present in the Asn-43 oligosaccharide. The predominant O-glycans are mono-sialylated forms of the disaccharide, Gal-beta-1,3GalNAc, and their sites of attachment are probably on Thr-76 and Thr-77. The GPI-anchor of soluble urinary CD59 has no inositol-associated phospholipid, but is composed of seven different GPI-anchor variants of one or more monosaccharide units. Major variants contain sialic acid, mannose and glucosamine. Sialic acid linked to an N-acetylhexosamine-galactose arm is present in two variants.

Glycated. Glycation is found in diabetic subjects, but only at minimal levels in nondiabetic subjects. Glycated CD59 lacks MAC-inhibitory function and confers to vascular complications of diabetes.

Subcellular Location:

Cell membrane>Lipid-anchor. Secreted.
Note: Soluble form found in a number of tissues.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Organismal Systems > Immune system > Complement and coagulation cascades.   (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

References

1). Improved production of GTKO/hCD55/hCD59 triple-gene-modified Diannan miniature pigs for xenotransplantation by recloning. TRANSGENIC RESEARCH, 2020 (PubMed: 32358721) [IF=2.7]

Application: WB    Species: human    Sample: 293T (human cell positive control) and fetuses F6# and F11#

Fig. 1 | Generation and identification of fetuses with GTKO/hCD55/hCD59. a Detection of GGTA1 (752-bp PCR product) in fetuses by PCR. b Genotyping of GGTA1 mutant fetuses by the T7EI assay. c The detection of hCD55 and hCD59 in fetuses by PCR. d Sequences of the GGTA1 and its mutations in WT,donor cells and fetuses. e The expression of hCD55 and hCD59 in 293T (human cell positive control) and fetuses F6# and F11#determined by western blotting

Application: IF/ICC    Species: piglet    Sample: kidneys

Fig. 3 |a Expression of GGTA1, hCD55 and hCD59 in the kidneys of piglet P5#by immunofluorescence. Green and red indicate the protein of interest. Scale bars = 100 lm at 9 200 magnification.

2). Generation of GTKO Diannan Miniature Pig Expressing Human Complementary Regulator Proteins hCD55 and hCD59 via T2A Peptide-Based Bicistronic Vectors and SCNT. MOLECULAR BIOTECHNOLOGY, 2018 (PubMed: 29916131) [IF=2.4]

Application: IHC    Species: pig    Sample: heart、liver、kidney and pancreas

Fig. 4|  IHC analysis in various tissues of GTKO/hCD55/hCD59 genetically modified piglet. a–c The GGTA1, hCD55, and hCD59 expression levels in fibroblasts from control and GTKO/hCD55/hCD59 piglets were measured by immunohistochemistry. The brown color indicates the protein of interest. Scale bars = 80 µm at ×200 magnification

Application: WB    Species: pig    Sample: liver and kidney

Fig. 5|  The expression analysis of hCD55 and hCD59 in GTKO/hCD55/hCD59 genetically modified piglet and human serum-mediated cytotoxicity. c The protein levels of hCD55 and hCD59 in the liver and kidney tissues analyzed by western blotting.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.