Product: S100A8 Antibody
Catalog: DF6556
Description: Rabbit polyclonal antibody to S100A8
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 11kDa; 11kD(Calculated).
Uniprot: P05109
RRID: AB_2838518

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
S100A8 Antibody detects endogenous levels of total S100A8.
RRID:
AB_2838518
Cite Format: Affinity Biosciences Cat# DF6556, RRID:AB_2838518.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

60B8Ag; AI323541; B8Ag; BEE11; CAGA; Calgranulin-A; Calprotectin L1L subunit; Calprotectin, included; CFAG; CGLA; Chemotactic cytokine CP-10; CP-10; Cystic fibrosis antigen; L1Ag; Leukocyte L1 complex light chain; MA387; MIF; Migration inhibitory factor-related protein 8; MRP-8; Myeloid-related protein 8; Neutrophil cytosolic 7 kDa protein; NIF; p8; Pro-inflammatory S100 cytokine; Protein S100-A8; S100 calcium binding protein A8 (calgranulin A); S100 calcium binding protein A8; S100 calcium-binding protein A8; S100A8; S100A8/S100A9 complex, included; S10A8_HUMAN; Urinary stone protein band A;

Immunogens

Immunogen:

A synthesized peptide derived from human S100A8, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P05109 S10A8_HUMAN:

Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutrophils and monocytes but are absent in normal tissue macrophages and lymphocytes. Under chronic inflammatory conditions, such as psoriasis and malignant disorders, also expressed in the epidermis. Found in high concentrations at local sites of inflammation or in the serum of patients with inflammatory diseases such as rheumatoid, cystic fibrosis, inflammatory bowel disease, Crohn's disease, giant cell arteritis, cystic fibrosis, Sjogren's syndrome, systemic lupus erythematosus, and progressive systemic sclerosis. Involved in the formation and deposition of amyloids in the aging prostate known as corpora amylacea inclusions. Strongly up-regulated in many tumors, including gastric, esophageal, colon, pancreatic, bladder, ovarian, thyroid, breast and skin cancers.

Description:
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq, Jul 2008]
Sequence:
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Research Backgrounds

Function:

S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread. The iNOS-S100A8/A9 transnitrosylase complex directs selective inflammatory stimulus-dependent S-nitrosylation of GAPDH and probably multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 seems to contribute to S-nitrosylation site selectivity.

Subcellular Location:

Secreted. Cytoplasm. Cytoplasm>Cytoskeleton. Cell membrane>Peripheral membrane protein.
Note: Predominantly localized in the cytoplasm. Upon elevation of the intracellular calcium level, translocated from the cytoplasm to the cytoskeleton and the cell membrane. Upon neutrophil activation or endothelial adhesion of monocytes, is secreted via a microtubule-mediated, alternative pathway.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutrophils and monocytes but are absent in normal tissue macrophages and lymphocytes. Under chronic inflammatory conditions, such as psoriasis and malignant disorders, also expressed in the epidermis. Found in high concentrations at local sites of inflammation or in the serum of patients with inflammatory diseases such as rheumatoid, cystic fibrosis, inflammatory bowel disease, Crohn's disease, giant cell arteritis, cystic fibrosis, Sjogren's syndrome, systemic lupus erythematosus, and progressive systemic sclerosis. Involved in the formation and deposition of amyloids in the aging prostate known as corpora amylacea inclusions. Strongly up-regulated in many tumors, including gastric, esophageal, colon, pancreatic, bladder, ovarian, thyroid, breast and skin cancers.

Family&Domains:

Belongs to the S-100 family.

Research Fields

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). S100A8 promotes epithelial‐mesenchymal transition and metastasis under TGF‐β/USF2 axis in colorectal cancer. Cancer Communications, 2021 (PubMed: 33389821) [IF=16.2]

Application: IHC    Species: human    Sample: CRC tissues

FIGURE 4| USF2 promotes migration and invasion in CRC cells and is associated with cancer progression and poor survival in CRC patients. A.USF2 overexpression enhanced cell migration and invasion in SW480 and HCT8 cells. B. USF2 knockdown inhibited cell migration and invasion in DLD1 and HT29 cells. C. Representative IHC images showed the coexpression of USF2 cytoplasmic staining (right panel) and S100A8 (left panel) in CRC tissues.

Application: WB    Species: human    Sample: HCT8 cells

FIGURE 2| S100A8 promoted EMT. A-B. S100A8 overexpression decreased E-cadherin, increased Vimentin and nuclear Snail, and changed the cells to a spindle-like morphology in SW480 (A) and HCT8 (B) cells.

2). Exosome-derived long non-coding RNA AC010789.1 modified by FTO and hnRNPA2B1 accelerates growth of hair follicle stem cells against androgen alopecia by activating S100A8/Wnt/β-catenin signalling. Clinical and translational medicine, 2025 (PubMed: 39748192) [IF=7.9]

Application: WB    Species: Mouse    Sample: HFSCs

FIGURE 5 S100A8 was identified as a downstream regulator of AC010789.1 to promote hair follicle stem cells (HFSCs) growth by activating Wnt/β-catenin signalling (A) RNA pull-down analysis of the interaction of S100A8 protein with the AC010789.1 mRNAs in HFSCs. (B) RIP analysis of the endogenous enrichment of AC010789.1 mRNAs in S100A8 protein in HFSCs. (C, D) Real-time quantitative polymerase chain reaction (qRT-PCR) and Western blot analysis of the expression levels of S100A8 after the transfection with AC010789.1 OE lentiviruses or si-AC010789.1 into HFSCs. (E, F) qRT-PCR and Western blot analysis of the expression levels of S100A8, K6HF and Lgr5 after the transfection of si-AC010789.1 into HFSCs. (G-I) CCK8, 5-ethynyl-2'-deoxyuridine assay (EdU) and Transwell analysis of the cell proliferation and migration viability after the co-transfection with AC010789.1 OE lentiviruses and si-S100A8 into HFSCs. (J) Western blot analysis of the expression levels of S100A8, Wnt10b, β-catenin and c-myc after the co-transfection with AC010789.1 OE lentiviruses and si-S100A8 into HFSCs. Data shown are the mean ± SEM of three experiments. **p < .01, ***p < .001 and ****p < .0001.

3). Transcriptomics Reveals Effect of Pulsatilla Decoction Butanol Extract in Alleviating Vulvovaginal Candidiasis by Inhibiting Neutrophil Chemotaxis and Activation via TLR4 Signaling. Pharmaceuticals (Basel, Switzerland), 2024 (PubMed: 38794163) [IF=4.6]

Application: WB    Species: Mouse    Sample:

Figure 13. BEPD downregulated the expression of chemokine-associated proteins (Western blots). Western blots were utilized to detect the expression of CXCL1, CXCL3, S100A8, and S100A9 proteins. Values are presented as mean ± SD. n = 3. ** p < 0.01, vs. control group; *** p < 0.01, vs. control group; # p < 0.05, vs. model group; ## p < 0.01, vs. model group; ### p < 0.001, vs. model group. BEPD, n-butanol extract of Pulsatilla decoction; BEPD-L, low-dose BEPD group (20 mL/kg); BEPD-M, medium-dose BEPD group (40 mL/kg); BEPD-H, high-dose BEPD group (80 mL/kg); Flu, fluconazole group.

4). Identification of S100A8/A9 involved in thromboangiitis obliterans development using tandem mass tags-labeled quantitative proteomics analysis. Cellular signalling, 2024 (PubMed: 38697446) [IF=4.4]

5). Proteomic and network pharmacology analyses reveal S100A8 as the anti-inflammatory target of Yunpi Jiedu Tongluo Qushi Granule in the treatment of rheumatoid arthritis. Journal of pharmaceutical and biomedical analysis, 2024 (PubMed: 39442465) [IF=3.1]

6). Unraveling the superiority of (−)-gallocatechin gallate to (−)-epigallocatechin-3-gallate in protection of diabetic nephropathy of db/db mice. Food Frontiers, 2024

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.