MPZ Antibody - #DF6555
Product: | MPZ Antibody |
Catalog: | DF6555 |
Description: | Rabbit polyclonal antibody to MPZ |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
Mol.Wt.: | 28kDa; 28kD(Calculated). |
Uniprot: | P25189 |
RRID: | AB_2838517 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6555, RRID:AB_2838517.
Fold/Unfold
Charcot Marie Tooth neuropathy 1B; CHM; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; CMTDID; DSS; HMSNIB; MPP; MPZ; Myelin peripheral protein; Myelin protein P0; Myelin protein zero; MYP0_HUMAN; P0;
Immunogens
- P25189 MYP0_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P25189 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S78 | Phosphorylation | Uniprot | |
Y82 | Phosphorylation | Uniprot | |
T139 | Phosphorylation | Uniprot | |
Y154 | Phosphorylation | Uniprot | |
Y177 | Phosphorylation | Uniprot | |
Y181 | Phosphorylation | Uniprot | |
S195 | Phosphorylation | Uniprot | |
T216 | Phosphorylation | Uniprot | |
Y220 | Phosphorylation | Uniprot | |
S226 | Phosphorylation | Uniprot | |
S233 | Phosphorylation | Uniprot |
Research Backgrounds
Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction.
N-glycosylated; contains sulfate-substituted glycan.
Cell membrane>Single-pass type I membrane protein.
Myelin membrane>Single-pass type I membrane protein.
Found only in peripheral nervous system Schwann cells.
Homodimer and homotetramer.
Belongs to the myelin P0 protein family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.