Product: CCL4 Antibody
Catalog: DF6545
Description: Rabbit polyclonal antibody to CCL4
Application: WB IHC IF/ICC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 10kDa; 10kD(Calculated).
Uniprot: P13236
RRID: AB_2838507

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(91%), Horse(100%), Rabbit(82%), Dog(91%)
Clonality:
Polyclonal
Specificity:
CCL4 Antibody detects endogenous levels of total CCL4.
RRID:
AB_2838507
Cite Format: Affinity Biosciences Cat# DF6545, RRID:AB_2838507.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

MIP 1 beta; Secreted protein G 26; ACT 2; ACT-2; ACT2; AT744.1; AT744.2; C C motif chemokine 4; C C motif chemokine 4 like; C C motif chemokine ligand 4 like 1; C C motif chemokine ligand 4 like 2; CC chemokine ligand 4; CC chemokine ligand 4L1; CC chemokine ligand 4L1d2; CC chemokine ligand 4L2; CCL4; CCL4_HUMAN; ccl4l 1; CCL4L; CCL4L1; Chemokine (C C motif) ligand 4; Chemokine (C C motif) ligand 4 like 1; Chemokine (C C motif) ligand 4 like 1, telomeric; Chemokine (C C motif) ligand 4 like 2; Chemokine CC Motif Ligand 4; G 26; G 26 T lymphocyte secreted protein; G-26 T-lymphocyte-secreted protein; HC21; Immune activation 2; LAG 1; LAG-1; LAG1; Lymphocyte activation gene 1; Lymphocyte activation gene 1 protein; Macrophage inflammatory protein 1 beta; Macrophage inflammatory protein 1-beta; Macrophage inflammatory protein 1b2; MGC104418; MGC126025; MGC126026; MIP-1-beta; MIP-1-beta(1-69); MIP-1-beta(3-69); MIP1 beta; MIP1B; MIP1B1; Monocyte adherence induced protein 5 alpha; PAT 744; Protein H400; SCYA2; SCYA4; SCYA4L; SCYA4L1; SCYA4L2; SCYQ4L2; Secreted protein G 26; Secreted protein G26; SIS gamma; SIS-gamma; Small inducible cytokine A4 (homologous to mouse Mip 1b); Small inducible cytokine A4; small inducible cytokine A4-like; Small-inducible cytokine A4; T cell activation protein 2; T-cell activation protein 2;

Immunogens

Immunogen:

A synthesized peptide derived from human CCL4, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
Chemokines are members of a superfamily of small inducible, secreted, pro-inflammatory cytokines. Members of the chemokine family exhibit 20 to 50% homology in their predicted amino acid sequences and are divided into four subfamilies. In C-C (or b) subfamily, the first two cysteines are adjacent. C-C chemokines are chemoattractants and activators for monocytes and T cells. C-C subfamily members include macrophage inflammatory protein (MIP)-1 , MIP-1∫, MIP-2, MIP-3 , MIP-3∫, MIP-4, HCC-1, MIP-5 (or HCC-2), RANTES, MCP-1/2/3 (and the murine homologs JE and MARC), I-309, murine C10 and TCA3. Research has shown that MIP-1∫ is more selective than MIP-1 , primarily attracting CD4+ T lymphocytes, with a preference for T cells of the naive phenotype. MIP-1 is a more potent lymphocyte chemoattractant than MIP-1∫ and exhibits a broader range of chemoattractant specificities. It has been suggested that CD8+ T lymphocytes are involved in the control of HIV infection in vivo by the release of HIV-suppressive factors (HIV-SF). MIP-1 has been identified as one of the major HIV-SFs produced by CD8+ T cells, along with MIP-1∫ and RANTES. Recombinant human MIP-1 acts as an inhibitor of different strains of HIV-1, HIV-2 and SIV infection in a dose-dependent manner.
Sequence:
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
91
Dog
91
Rabbit
82
Chicken
71
Sheep
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.

PTMs:

N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

References

1). Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy. Cancer cell, 2024 (PubMed: 39515328) [IF=48.8]

2). Isosteviol reduces the acute inflammatory response after burns by upregulating MMP9 in macrophages leading to M2 polarization. International Immunopharmacology, 2022 (PubMed: 35176589) [IF=4.8]

3). CDK4/6i enhances the antitumor effect of PD1 antibody by promoting TLS formation in ovarian cancer. Heliyon, 2023 (PubMed: 37809574) [IF=4.0]

Application: IHC    Species: Mouse    Sample:

Fig. 5 RT-QPCR showed the expression of SCD1 and its regulatory genes ATF3 and CCL4 expression in tumor tissues of mice (n = 3) (A–C). The expression of SCD1, ATF3, CCL4 and infiltration of CD8+T cells were detected in tumor tissues of mice in different treatment groups by IHC (D–H). The protein levels of SCD1, ATF3 and CCL4 in mouse tumor tissues were detected by western blotting (I–L).

4). Bioinformatics and system biology analysis revealed the crosstalk between COVID-19 and osteoarthritis. Immunity, inflammation and disease, 2023 (PubMed: 38156385) [IF=3.2]

5). Identification and preliminary validation of differently expressed genes as candidate biomarkers associated with atherosclerosis. Gene, 2024 (PubMed: 38527674) [IF=2.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.