CCL4 Antibody - #DF6545
Product: | CCL4 Antibody |
Catalog: | DF6545 |
Description: | Rabbit polyclonal antibody to CCL4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
Mol.Wt.: | 10kDa; 10kD(Calculated). |
Uniprot: | P13236 |
RRID: | AB_2838507 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6545, RRID:AB_2838507.
Fold/Unfold
MIP 1 beta; Secreted protein G 26; ACT 2; ACT-2; ACT2; AT744.1; AT744.2; C C motif chemokine 4; C C motif chemokine 4 like; C C motif chemokine ligand 4 like 1; C C motif chemokine ligand 4 like 2; CC chemokine ligand 4; CC chemokine ligand 4L1; CC chemokine ligand 4L1d2; CC chemokine ligand 4L2; CCL4; CCL4_HUMAN; ccl4l 1; CCL4L; CCL4L1; Chemokine (C C motif) ligand 4; Chemokine (C C motif) ligand 4 like 1; Chemokine (C C motif) ligand 4 like 1, telomeric; Chemokine (C C motif) ligand 4 like 2; Chemokine CC Motif Ligand 4; G 26; G 26 T lymphocyte secreted protein; G-26 T-lymphocyte-secreted protein; HC21; Immune activation 2; LAG 1; LAG-1; LAG1; Lymphocyte activation gene 1; Lymphocyte activation gene 1 protein; Macrophage inflammatory protein 1 beta; Macrophage inflammatory protein 1-beta; Macrophage inflammatory protein 1b2; MGC104418; MGC126025; MGC126026; MIP-1-beta; MIP-1-beta(1-69); MIP-1-beta(3-69); MIP1 beta; MIP1B; MIP1B1; Monocyte adherence induced protein 5 alpha; PAT 744; Protein H400; SCYA2; SCYA4; SCYA4L; SCYA4L1; SCYA4L2; SCYQ4L2; Secreted protein G 26; Secreted protein G26; SIS gamma; SIS-gamma; Small inducible cytokine A4 (homologous to mouse Mip 1b); Small inducible cytokine A4; small inducible cytokine A4-like; Small-inducible cytokine A4; T cell activation protein 2; T-cell activation protein 2;
Immunogens
- P13236 CCL4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
Secreted.
Homodimer and heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69).
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.