VTN Antibody | Affinity Biosciences

1/1

Western blot analysis of extracts from human serum tissue, using VTN antibody.

Product:	VTN Antibody
Catalog:	DF6542
Description:	Rabbit polyclonal antibody to VTN
Application:	WB IHC
Reactivity:	Human, Mouse
Mol.Wt.:	54kDa; 54kD(Calculated).
Uniprot:	P04004
RRID:	AB_2838504

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse

Clonality:

Polyclonal

Specificity:

VTN Antibody detects endogenous levels of total VTN.

RRID:

AB_2838504
Cite Format: Affinity Biosciences Cat# DF6542, RRID:AB_2838504.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Complement S Protein; Epibolin; S Protein; S-protein; Serum Spreading Factor; Serum-spreading factor; Somatomedin B; Somatomedin-B; V75; Vitronectin V10 subunit; Vitronectin V65 subunit; VN; VNT; VTN; VTNC_HUMAN;

Immunogens

Immunogen:

Uniprot:

P04004(VTNC_HUMAN) >>Visit HPA database.

Gene(ID):

VTN(7448)

Expression:

P04004 VTNC_HUMAN:

Expressed in the retina pigment epithelium (at protein level) (PubMed:25136834). Plasma.

Description:

The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. [provided by RefSeq, Jul 2008]

Sequence:

P04004 VTNC_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

PTMs - P04004 As Substrate

P04004

Site	PTM Type	Enzyme	Source
T69	Phosphorylation	P68400 (CSNK2A1)	Uniprot
Y75	Phosphorylation		Uniprot
T76	Phosphorylation	P68400 (CSNK2A1)	Uniprot
N86	N-Glycosylation		Uniprot
S106	Phosphorylation		Uniprot
S130	Phosphorylation		Uniprot
S137	Phosphorylation		Uniprot
T141	Phosphorylation		Uniprot
N169	N-Glycosylation		Uniprot
S171	Phosphorylation		Uniprot
Y179	Phosphorylation		Uniprot
K218	Acetylation		Uniprot
T219	Phosphorylation		Uniprot
N242	N-Glycosylation		Uniprot
S312	Phosphorylation		Uniprot
T325	Phosphorylation		Uniprot
S357	Phosphorylation		Uniprot
S364	Phosphorylation		Uniprot
S381	Phosphorylation	P05771 (PRKCB) , P17252 (PRKCA) , P05129 (PRKCG)	Uniprot
S386	Phosphorylation	P17252 (PRKCA)	Uniprot
S393	Phosphorylation	P17252 (PRKCA)	Uniprot
S397	Phosphorylation	P17252 (PRKCA) , P17612 (PRKACA)	Uniprot
S406	Phosphorylation		Uniprot
S407	Phosphorylation		Uniprot
Y420	Phosphorylation		Uniprot

Research Backgrounds

P04004_VTNC_HUMAN

Function:

Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.

Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity.

PTMs:

Sulfated on tyrosine residues.

N- and O-glycosylated.

Phosphorylation on Thr-69 and Thr-76 favors cell adhesion and spreading.

It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.

Phosphorylation sites are present in the extracellular medium.

Subcellular Location:

Secreted>Extracellular space.

Tissue Specificity:

Expressed in the retina pigment epithelium (at protein level). Plasma.

Subunit Structure:

Exists in two forms: a single chain 75 kDa form (V75) and a clipped form composed of two chains (65 kDa and 10 kDa) (V65+V10) which are held together by a disulfide bond. Interacts with SERPINE1/PAI1, insulin and C1QBP.

Family&Domains:

The SMB domain mediates interaction with SERPINE1/PAI1. The heparin-binding domain mediates interaction with insulin.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > ECM-receptor interaction. (View pathway)

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

VTN Antibody - #DF6542