Product: AHSG Antibody
Catalog: DF6528
Description: Rabbit polyclonal antibody to AHSG
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 39kDa; 39kD(Calculated).
Uniprot: P02765
RRID: AB_2838490

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
AHSG Antibody detects endogenous levels of total AHSG.
RRID:
AB_2838490
Cite Format: Affinity Biosciences Cat# DF6528, RRID:AB_2838490.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

59 kDa bone sialic acid-containing protein; A2HS; Aa2-066; AHS; Ahsg alpha-2-HS-glycoprotein; Ahsg; Alpha 2 HS Glycoprotein; Alpha 2 Z globulin; Alpha-2-HS-glycoprotein; Alpha-2-HS-glycoprotein chain B; Alpha-2-Z-globulin; Asialofetuin; Ba alpha 2 glycoprotein; Ba-alpha-2-glycoprotein; BSP; Countertrypin; Fetua; FETUA_HUMAN; Fetuin , mouse, homolog of; Fetuin A; Fetuin-A; Glycoprotein PP63; HSGA; pp63;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P02765 FETUA_HUMAN:

Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.

Description:
Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq, Jul 2008]
Sequence:
MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

PTMs - P02765 As Substrate

Site PTM Type Enzyme
S74 Phosphorylation
K131 Ubiquitination
S134 Phosphorylation
S135 Phosphorylation
S138 Phosphorylation
K144 Acetylation
K225 Acetylation
K225 Ubiquitination
Y227 Phosphorylation
K231 Methylation
T319 Phosphorylation
S325 Phosphorylation
S328 Phosphorylation
S330 Phosphorylation
S334 Phosphorylation
S346 O-Glycosylation

Research Backgrounds

Function:

Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.

PTMs:

Phosphorylated by FAM20C in the extracellular medium.

O- and N-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans. N-glycan at Asn-156: Hex5HexNAc4; N-glycan heterogeneity at Asn-176: Hex5HexNAc4 (major) and Hex6HexNAc5 (minor).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.

Subunit Structure:

Alpha-2-HS glycoprotein derives from this precursor, when the connecting peptide is cleaved off. The two chains A and B are held together by a single disulfide bond.

Family&Domains:

Belongs to the fetuin family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.