Product: Cathelicidin Antibody
Catalog: DF6523
Description: Rabbit polyclonal antibody to Cathelicidin
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 19kDa; 19kD(Calculated).
Uniprot: P49913
RRID: AB_2838485

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
Cathelicidin Antibody detects endogenous levels of total Cathelicidin.
RRID:
AB_2838485
Cite Format: Affinity Biosciences Cat# DF6523, RRID:AB_2838485.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

18 kDa cationic antimicrobial protein; Antibacterial peptide LL-37; Antibacterial protein FALL-39; CAMP; CAMP_HUMAN; CAP 18; CAP-18; CAP18; Cathelicidin antimicrobial peptide; Cathelin-like protein; Cathelin-related antimicrobial peptide; CATHL3; Cationic antimicrobial protein, 18-KD; CLP; Cnlp; Cramp; CRAMP, mouse, homolog of; FALL 39; FALL-39 peptide antibiotic; FALL39; hCAP 18; hCAP-18; hCAP18; HSD26; LL37; MCLP; Peptide antibiotic, PR-39, porcine, homolog of;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P49913 CAMP_HUMAN:

Expressed in bone marrow and testis and neutrophils.

Description:
This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The encoded protein has several functions in addition to antimicrobial activity, including cell chemotaxis, immune mediator induction and inflammatory response regulation. [provided by RefSeq, Aug 2011]
Sequence:
MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

PTMs - P49913 As Substrate

Site PTM Type Enzyme
S50 Phosphorylation
S51 Phosphorylation

Research Backgrounds

Function:

Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

PTMs:

The N-terminus is blocked.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in bone marrow and testis and neutrophils.

Family&Domains:

Belongs to the cathelicidin family.

Research Fields

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Digestive system > Salivary secretion.

References

1). Increased S. Aureus Colonization and Reduced Antimicrobial Peptide Expression in Erythrodermic Psoriasis. International immunopharmacology, 2024 (PubMed: 38096593) [IF=5.6]

2). Patchouli oil ameliorates 5-fluorouracil-induced intestinal mucositis in rats via protecting intestinal barrier and regulating water transport. JOURNAL OF ETHNOPHARMACOLOGY, 2020 (PubMed: 31883475) [IF=5.4]

Application: WB    Species: rat    Sample: intestinal

Fig. 9.| Effect of P.oil on the expression of VIP, cAMP, and PKA (n = 3–5). (A) Representative western blotting band. The expressions of VIP (B), cAMP (C) and PKA(D).

3). Combination of pseudoephedrine and emodin ameliorates LPS-induced acute lung injury by regulating macrophage M1/M2 polarization through the VIP/cAMP/PKA pathway. Chinese Medicine, 2022 (PubMed: 35123524) [IF=4.9]

Application: WB    Species: Rat    Sample: lung tissues 

Fig. 6 Pseudoephedrine + emodin up-regulated VIP/CAMP/PKA pathways and Inhibited NF-κB in LPS-induced acute lung injury in rats. A, D VIP, cAMP mRNA expression was determined using Real-time PCR analysis. B, C, E–H Western blot analysis was performed to detect VIP, cAMP, p-PKA, p-IκBα and p-P65 protein expression. All data are expressed as mean ± S.D. (n = 3). ##p < 0.01, ###p < 0.001 vs. control group. *p < 0.05, **p < 0.01, ***p < 0.001 vs. LPS alone group. +p < 0.05, ++p < 0.01, +++p < 0.001 vs. combined treatment group (5 + 20 mg/kg)

4). Liver proteomic analysis reveals acute liver failure induced by lipopolysaccharide/D-galactosamine in rats involved in neutrophil extracellular trap formation. European Journal of Inflammation, 2022 [IF=0.7]

Application: WB    Species: Rat    Sample: Liver

Figure 4. Lipopolysaccharide (LPS)/D-galactosamine (D-Gal)-induced acute liver failure (ALF) in rats involved in neutrophil extracellular trap (NET) formation. (a) Validation of selected differentially expressed proteins of cathelicidin antimicrobial peptide (CAMP), myeloperoxidase (MPO), and fibrinogen gamma chain (FGG) in the liver samples ofrats after LPS/D-Gal administration for different time periods using western blotting analysis in the validation cohort. (b) Serum MPO-DNA levels, (c) citrullination of histone H3 (Cit-H3) levels, (d) tumour necrosis factor-α (TNF-α) levels, and (e) interleukin-6 (IL-6) levels were measured in rats with LPS/D-Gal administration for different time periods, respectively.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.