OLR1 Antibody - #DF6522

(2)   (5)  
Product: OLR1 Antibody
Catalog: DF6522
Description: Rabbit polyclonal antibody to OLR1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 30~55kDa; 31kD(Calculated).
Uniprot: P78380
RRID: AB_2838484

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
OLR1 Antibody detects endogenous levels of total OLR1.
RRID:
AB_2838484
Cite Format: Affinity Biosciences Cat# DF6522, RRID:AB_2838484.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-type lectin domain family 8 member A; CLEC8A; hLOX 1; hLOX-1; Lectin like oxidized LDL receptor 1; Lectin like oxLDL receptor 1; Lectin type oxidized LDL receptor 1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; Lectin-type oxidized LDL receptor 1; low density lipoprotein oxidized, receptor 1; LOX-1; LOXIN; Olr1; OLR1_HUMAN; Ox LDL receptor 1; Ox-LDL receptor 1; Oxidised low density lipoprotein (lectin like) receptor 1; Oxidized low density lipoprotein receptor 1; Oxidized low density lipoprotein receptor 1 soluble form; Oxidized low-density lipoprotein receptor 1; SCARE1; Scavenger receptor class E, member 1; SLOX1; soluble form; SR-EI;

Immunogens

Immunogen:
Uniprot:

P78380(OLR1_HUMAN) >>Visit HPA database.

Gene(ID):
OLR1(4973)
Expression:
P78380 OLR1_HUMAN:

Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate and low level.

Description:
This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.
Sequence:
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

PTMs - P78380 As Substrate

Site PTM Type Enzyme
K7 Ubiquitination
K12 Ubiquitination
S19 Phosphorylation
K80 Ubiquitination
S95 Phosphorylation
S98 Phosphorylation
K112 Ubiquitination
K118 Ubiquitination
N139 N-Glycosylation
K171 Ubiquitination
K178 Ubiquitination

Research Backgrounds

Function:

Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.

PTMs:

The intrachain disulfide-bonds prevent N-glycosylation at some sites.

N-glycosylated.

Subcellular Location:

Cell membrane>Lipid-anchor. Cell membrane>Single-pass type II membrane protein. Membrane raft. Secreted.
Note: A secreted form also exists. Localization to membrane rafts requires palmitoylation.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate and low level.

Subunit Structure:

Homodimer; disulfide-linked. May form a hexamer composed of 3 homodimers. Interacts with HSP70.

Family&Domains:

The cytoplasmic region is required for subcellular sorting on the cell surface.

The C-type lectin domain mediates the recognition and binding of oxLDL.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Organismal Systems > Endocrine system > PPAR signaling pathway.

References

1). MiR-144-5p limits experimental abdominal aortic aneurysm formation by mitigating M1 macrophage-associated inflammation: Suppression of TLR2 and OLR1. JOURNAL OF MOLECULAR AND CELLULAR CARDIOLOGY, 2020 (PubMed: 32278833) [IF=5.0]
2). LOX-1 attenuates high glucose-induced autophagy via AMPK/HNF4α signaling in HLSECs. Heliyon, 2022 (PubMed: 36590506) [IF=4.0]

Application: WB    Species: Human    Sample: HLSECs

Figure 1 The effect of high glucose on the expression levels of LOX-1, Beclin-1, and LC3II in HLSECs transfected by recombinant LV-LOX-1. HLSECs were treated with high glucose (HG), HG + recombinant lentivirus LOX-1 (LV-LOX-1), and HG + control lentiviral cells (LV-CON) for 72 h. (A–C) The mRNA expression levels of LOX-1, Beclin-1, and LC3II in HLSECs within 72 h after treatment with HG (25 mM), LV-LOX-1, and LV-CON. (D) The protein expression levels of each group were detected using western blotting (see original blots in Supplemental Figure 1D). (E–G) Western blotting analysis of the protein expression levels of LOX-1, Beclin-1, and LC3II in HLSECs within 72 h after treatment with HG and/or LV-LOX-1 and LV-CON. Western blot and qRT-PCR analyses were used to normalize the levels of GAPDH and β-actin (n = 3 independent experiments). All results are expressed as mean ± SD. ∗∗∗P < 0.001 versus the NC group; ###P < 0.001 versus HG + LV-CON group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.