TFPI Antibody - #DF6511
| Product: | TFPI Antibody |
| Catalog: | DF6511 |
| Description: | Rabbit polyclonal antibody to TFPI |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit, Chicken |
| Mol.Wt.: | 35kDa; 35kD(Calculated). |
| Uniprot: | P10646 |
| RRID: | AB_2838473 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6511, RRID:AB_2838473.
Fold/Unfold
Anti convertin; EPI; Extrinsic pathway inhibitor; LACI; Lipoprotein associated coagulation inhibitor; Lipoprotein-associated coagulation inhibitor; TFI; TFPI 1; TFPI; TFPI1; TFPI1_HUMAN; Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor); Tissue factor pathway inhibitor;
Immunogens
A synthesized peptide derived from human TFPI, corresponding to a region within the internal amino acids.
- P10646 TFPI1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
O-glycosylated.
Secreted.
Microsome membrane>Lipid-anchor.
Mostly in endothelial cells.
This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa.
Research Fields
· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.