SELL Antibody - #DF6509
Product: | SELL Antibody |
Catalog: | DF6509 |
Description: | Rabbit polyclonal antibody to SELL |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 42kDa; 42kD(Calculated). |
Uniprot: | P14151 |
RRID: | AB_2838471 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6509, RRID:AB_2838471.
Fold/Unfold
A.11; AI528707; CD62 antigen ligand; CD62 antigen-like family member L; CD62L; gp90-MEL; IgA nephropathy, susceptibility to, included; L Selectin; L-selectin; LAM-1; LAM1; LECAM1; LEU8; Leukocyte adhesion molecule 1; Leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; Lnhr; LSEL; Ly-22; Ly-m22; Lyam-1; LYAM1; LYAM1_HUMAN; Lymph node homing receptor; Lymphocyte adhesion molecule 1; Lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; MEL-14; Pln homing receptor; PLNHR; Selectin L; Selectin, lymphocyte; SELL; TQ1;
Immunogens
- P14151 LYAM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P14151 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N60 | N-Glycosylation | Uniprot | |
K78 | Ubiquitination | Uniprot | |
K93 | Ubiquitination | Uniprot | |
N104 | N-Glycosylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K122 | Ubiquitination | Uniprot | |
K125 | Ubiquitination | Uniprot | |
Y132 | Phosphorylation | Uniprot | |
K134 | Ubiquitination | Uniprot | |
K137 | Ubiquitination | Uniprot | |
K141 | Ubiquitination | Uniprot | |
K149 | Ubiquitination | Uniprot | |
N177 | N-Glycosylation | Uniprot | |
K300 | Ubiquitination | Uniprot | |
K318 | Ubiquitination | Uniprot | |
K321 | Ubiquitination | Uniprot | |
S364 | Phosphorylation | Uniprot | |
S367 | Phosphorylation | Uniprot |
Research Backgrounds
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
N-glycosylated.
Cell membrane>Single-pass type I membrane protein.
Expressed in B-cell lines and T-lymphocytes.
Interaction with SELPLG/PSGL1 and PODXL2 is required for promoting recruitment and rolling of leukocytes. This interaction is dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, and tyrosine sulfation modifications of SELPLG. Sulfation on 'Tyr-51' of SELPLG is important for L-selectin binding.
Belongs to the selectin/LECAM family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.