FABP2 Antibody - #DF6508
Product: | FABP2 Antibody |
Catalog: | DF6508 |
Description: | Rabbit polyclonal antibody to FABP2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 15kDa; 15kD(Calculated). |
Uniprot: | P12104 |
RRID: | AB_2838470 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6508, RRID:AB_2838470.
Fold/Unfold
FABP 2; FABP2; FABPI; FABPI_HUMAN; Fatty acid binding protein 2 intestinal; Fatty acid binding protein; Fatty acid binding protein intestinal; Fatty acid-binding protein 2; Fatty acid-binding protein; I FABP; I-FABP; IFABP; intestinal; Intestinal fatty acid binding protein 2; Intestinal-type fatty acid-binding protein; MGC133132; OTTHUMP00000163925;
Immunogens
Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.
- P12104 FABPI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P12104 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y15 | Phosphorylation | Uniprot | |
Y71 | Phosphorylation | Uniprot |
Research Backgrounds
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
Cytoplasm.
Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.
Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Research Fields
· Organismal Systems > Endocrine system > PPAR signaling pathway.
· Organismal Systems > Digestive system > Fat digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.