Claudin 2 Antibody - #AF0128

(16)   (19)  
Product: Claudin 2 Antibody
Catalog: AF0128
Description: Rabbit polyclonal antibody to Claudin 2
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 25kDa; 25kD(Calculated).
Uniprot: P57739
RRID: AB_2833312

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Claudin 2 Antibody detects endogenous levels of total Claudin 2.
RRID:
AB_2833312
Cite Format: Affinity Biosciences Cat# AF0128, RRID:AB_2833312.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, sodium azide and glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Claudin-2; Claudin2; CLD2_HUMAN; CLDN 2; CLDN2; OTTHUMP00000023793; SP 82; SP82;

Immunogens

Immunogen:

A synthesized peptide derived from human Claudin 2, corresponding to a region within C-terminal amino acids.

Uniprot:

P57739(CLD2_HUMAN) >>Visit HPA database.

Gene(ID):
CLDN2(9075)
Description:
claudin 2 Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Belongs to the claudin family. Can form homo- and heteropolymers with other CLDN. Homopolymers interact with CLDN3, but not CLDN1, homopolymers. Directly interacts with TJP1/ZO-1, TJP2/ZO-2 and TJP3/ZO-3
Sequence:
MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
78
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

PTMs:

The disulfide bond is necessary for pore formation, but is not required for correct protein trafficking.

Subcellular Location:

Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the claudin family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

References

1). Metasilicate-based alkaline mineral water confers diarrhea resistance in maternally separated piglets via the microbiota-gut interaction. Pharmacological research, 2023 (PubMed: 36436708) [IF=9.1]

Application: IF/ICC    Species: piglets    Sample:

Fig. 7. Effect of SMP water on intestinal barrier integrity in MS piglets under weaning stress. (A) Western blotting measurements of the protein levels of MLCK/p-MLC signaling and tight/adherens junction proteins in small intestine from MS piglets (Occludin, 60 kDa; ZO-1, 195 kDa; Claudin 5, 23 kDa; α-Catenin, 100 kDa; E-Catenin, 130 kDa; MLC, 50 kDa; p-MLC, 50, β-actin, 42 kDa). (B) Occludin/β-actin. (C) ZO-1/β-actin. (D) Claudin5/β-actin. (E) α-Catenin/β-actin. (F) E-Cadherin/β-actin. (G) The mRNA levels of MLCK in duodenum tissue. (H) MLC/β-actin. (I) p-MLC/β-actin. (J) Immunofluorescence images of ZO-1, Claudin2 staining (green) and DAPI (blue) of duodenum in MS piglets. (K-L) Mean density of (K) ZO-1 and (L) Claudin2 in duodenum of MS piglets. (M) Correlation analysis between MLCK/p-MLC signaling and its-mediated tight/adherens junction proteins and NF-κB signaling pathway. (N) Factors interaction network analysis of NF-κB signaling pathway, AQPs, fluid absorption/secretion proteins, MLCK/p-MLC signaling and tight/adherens junction proteins in small intestine from MS piglets under weaning stress. Data are presented as the mean ± SD. ns P > 0.05, * P 
2). Commensal cow Roseburia reduces gut-dysbiosis-induced mastitis through inhibiting bacterial translocation by producing butyrate in mice. Cell Reports, 2022 (PubMed: 36417859) [IF=7.5]

Application: WB    Species: Mouse    Sample:

Figure 5Commensal Roseburia ameliorates gut-dysbiosis-induced mastitis in mice
3). Exposure to okadaic acid could disrupt the colonic microenvironment in rats. Ecotoxicology and environmental safety, 2023 (PubMed: 37597294) [IF=6.2]

Application: IF/ICC    Species: Rat    Sample:

Fig. 4. Impaired cell junction in colonic epithelium after exposure to OA. (A) Representative immunofluorescent images of claudin2 (CLDN2, Orange), occluding (OCLN, Yellow), tight junction protein 1 (TJP1, Magenta) and cadherin 1 (CDH1, Cyan) in distal colon sections under laser scanning confocal microscope. Nuclei is stained blue (DAPI). Scale bars, 100 µm. (B) Relative expression of Cldn2, Ocln, Tjp1 and Cdh1 revealed by qPCR at the mRNA level. All data represent the mean ± sem (n = 6). *p
4). Effects of Dietary Colostrum Basic Protein on Bone Growth and Calcium Absorption in Mice. Nutrients, 2024 (PubMed: 38474792) [IF=5.9]

Application: WB    Species: Mouse    Sample:

Figure 5 Effect of CBP on calcium absorption and related proteins in mice. (a) Apparent absorption rate of calcium. (b–f) TRPV6, PMCA1, CaBP-9k, CLD2, and CLD12 in jejunum, (g,h) CLD2 and CLD12 in ileum levels in the five groups. Data are presented as mean ± SEM (n = 3). Statistical significance between groups is represented by different lowercase letters (p < 0.05).
5). Mesenchymal Stem Cells Overexpressing ACE2 Favorably Ameliorate LPS-Induced Inflammatory Injury in Mammary Epithelial Cells. Frontiers in Immunology, 2022 (PubMed: 35095873) [IF=5.7]

Application: WB    Species: Mice    Sample: EpH4-Ev cells

Figure 8 MSC-ACE2 upregulates blood-milk barrier-related protein expression to suppress LPS-induced inflammation in Eph4-EV cells. (A) Detection of relative protein expression levels of ZO-1, Claudin-1, Claudin-2 by Western blot; (B) Statistics of the ZO-1, Claudin-1, Claudin-2 Western blot results. Experiments were repeated three times and data were presented as the mean ± SEM (n = 4). * P < 0.05 vs. EpH4-Ev; # P < 0.05 vs. LPS; $ P < 0.05 vs. MSC; & P < 0.05 vs. MSC-GFP.
6). Long non-coding RNA ANRIL/p65 negative feedback loop protects intestinal barrier function in inflammatory bowel disease. Non-coding RNA research, 2025 (PubMed: 40242051) [IF=5.0]

Application: WB    Species: Mouse    Sample:

Fig. 2. ANRIL suppresses the expression of inflammatory factors and protects intestinal barrier function in DSS-induced mouse colitis. (A–D) RT-qPCR detection of expression levels of ANRIL, IL-6, TNF-α, and IL-1β in colon tissues of each mouse group. (E–G) ELISA detection of expression levels of IL-6, TNF-α, and IL-1β in colon tissues of each mouse group. (H) Assessment of intestinal permeability using the Fluorescein Isothiocyanate (FITC)-Dextran Permeability Assay. (I–L) Western blotting (WB) detection of expression levels of intestinal barrier-related proteins ZO-1, Claudin-2, and Occludin in colon tissues of each mouse group. (M–O) Immunofluorescence detection of expression of ZO-1, Claudin-2, and Occludin in colon tissues of each mouse group. ∗p < 0.05, ∗∗p < 0.01, ∗∗∗p < 0.001, ∗∗∗∗p < 0.0001. Data are expressed as mean ± standard deviation.

Application: IF/ICC    Species: Mouse    Sample:

Fig. 2. ANRIL suppresses the expression of inflammatory factors and protects intestinal barrier function in DSS-induced mouse colitis. (A–D) RT-qPCR detection of expression levels of ANRIL, IL-6, TNF-α, and IL-1β in colon tissues of each mouse group. (E–G) ELISA detection of expression levels of IL-6, TNF-α, and IL-1β in colon tissues of each mouse group. (H) Assessment of intestinal permeability using the Fluorescein Isothiocyanate (FITC)-Dextran Permeability Assay. (I–L) Western blotting (WB) detection of expression levels of intestinal barrier-related proteins ZO-1, Claudin-2, and Occludin in colon tissues of each mouse group. (M–O) Immunofluorescence detection of expression of ZO-1, Claudin-2, and Occludin in colon tissues of each mouse group. ∗p < 0.05, ∗∗p < 0.01, ∗∗∗p < 0.001, ∗∗∗∗p < 0.0001. Data are expressed as mean ± standard deviation.
7). Matrine protects against DSS-induced murine colitis by improving gut barrier integrity, inhibiting the PPAR-α signaling pathway, and modulating gut microbiota. International Immunopharmacology, 2021 (PubMed: 34474274) [IF=4.8]

Application: WB    Species: Mice    Sample: colon tissues

Fig. 4. Matrine improved gut barrier integrity in DSS-induced UC mice. (A) AB/ PAS and immunofluorescence imaging detected the mucin-producing cells and the expression of mucin-2, respectively. (B) Analysis of the expression levels of the mucin-producing cells and mucin-2. (C) The expressions of occludin, claudin-1,2, and ZO- 1 protein were verified by western blot. (D) Analysis of the expression levels of occludin, claudin-1,2, and ZO-1. Data are expressed as means ± SEM; n = 5 for each group. * P < 0.05, ** P < 0.01, *** P < 0.001, and ****P < 0.0001.

Application: WB    Species: mouse    Sample: colon

Fig. 4. |Matrine improved gut barrier integrity in DSS-induced UC mice.(C) The expressions of occludin, claudin-1,2, and ZO1 protein were verified by western blot.
8). The Combined Effect of Vitamin C and Vitamin D3 on the Intestinal Epithelial Barrier by Regulating Notch Signaling Pathway. Nutrition & Metabolism, 2021 (PubMed: 33964955) [IF=4.5]

Application: WB    Species: Human    Sample: SW480 cells

Fig. 4 Expression of tight junction-associated proteins and genes and Notch signaling pathway-related proteins and genes in SW480 cells. 1: control group; 2: LPS group; 3: VD3 group; 4: 0.1VC+ VD3 group; 5: 1VC+ VD3 group; 6: 5VC+ VD3 group; 7: 10VC+ VD3 group. a Western blotting results of claudin-2 in SW480 cells, b western blotting results of ZO-1 in SW480 cells, c western blotting results of Notch intracellular domain (NICD) in SW480 cells, d western blotting results of Hes-1 in SW480 cells, e RT-PCR of tight junction protein-related genes and Notch signaling pathway-related genes. In the fgure, a–f indicate signifcant diferences compared with the control group, LPS group, VD3 group, 0.1VC+ VD3 group, 1VC+ VD3 group, and 5VC+ VD3 group, respectively

Application: WB    Species: Human    Sample: SW480 cells

Fig. 4 Expression of tight junction-associated proteins and genes and Notch signaling pathway-related proteins and genes in SW480 cells. 1: control group; 2: LPS group; 3: VD3 group; 4: 0.1VC+ VD3 group; 5: 1VC+ VD3 group; 6: 5VC+ VD3 group; 7: 10VC+ VD3 group. a Western blotting results of claudin-2 in SW480 cells, b western blotting results of ZO-1 in SW480 cells, c western blotting results of Notch intracellular domain (NICD) in SW480 cells, d western blotting results of Hes-1 in SW480 cells, e RT-PCR of tight junction protein-related genes and Notch signaling pathway-related genes. In the fgure, a–f indicate signifcant diferences compared with the control group, LPS group, VD3 group, 0.1VC+ VD3 group, 1VC+ VD3 group, and 5VC+ VD3 group, respectively
9). Lacticaseibacillus casei IB1 Alleviates DSS-Induced Inflammatory Bowel Disease by Regulating the Microbiota and Restoring the Intestinal Epithelial Barrier. Microorganisms, 2024 (PubMed: 39065147) [IF=4.5]
10). Cr (VI) promotes tight joint and oxidative damage by activating the Nrf2/ROS/Notch1 axis. Environmental Toxicology and Pharmacology, 2021 (PubMed: 33757840) [IF=4.2]

Application: IHC    Species: mice    Sample: intestine

Fig. 1. Cr(VI)-induced tight joint and oxidative damage in the small intestine of mice. Cr(VI)- induced tight joint damage in the small intestine of mice (A–F). After Cr(VI) treatment, Zo- 2 and occludin protein levels were examined via Western blot analysis (A), and the relative ratios of Zo-2 and occludin were quantified in a histogram (B and C). Histopathological changes in the small intestine (D). IHC staining of Zo-1 and claudin-2 (E and F). The first lines of D, E, and F were the respective control groups (I and II), and the second line corresponded to 40 mg/kg Cr groups (III and IV). Higher magnification images of the outlined area are shown on the right (II and IV). Cr(VI)-induced oxidative damage in the small intestine of mice (G–I). Small intestinal homogenate samples were collected to examine the levels of SOD (G), MDA (H), and GSH-Px (I). Values in the same column with different superscripts (a, b, c, d) significantly differed and represented as mean ± SD. Differences with p < 0.05 were presented. All experimental data were obtained from three independent experiments.
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.