B2M Antibody - #DF6458
| Product: | B2M Antibody |
| Catalog: | DF6458 |
| Description: | Rabbit polyclonal antibody to B2M |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
| Mol.Wt.: | 14kDa; 14kD(Calculated). |
| Uniprot: | P61769 |
| RRID: | AB_2838420 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6458, RRID:AB_2838420.
Fold/Unfold
B2M; B2MG_HUMAN; Beta 2 microglobin; Beta 2 microglobulin; Beta 2 microglobulin precursor; Beta chain of mhc class 1 proteins; Beta chain of MHC class I molecules; Beta-2-microglobulin form pI 5.3; CDABP0092; Hdcma22p;
Immunogens
A synthesized peptide derived from human B2M, corresponding to a region within the internal amino acids.
- P61769 B2MG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its export to the cell surface (total protein levels do not change), probably leading to defects in class I antigen presentation.
Glycation of Ile-21 is observed in long-term hemodialysis patients.
Secreted. Cell surface.
Note: Detected in serum and urine (PubMed:1336137, PubMed:7554280).
Note: (Microbial infection) In the presence of M.tuberculosis EsxA-EsxB complex decreased amounts of B2M are found on the cell surface (PubMed:25356553).
Belongs to the beta-2-microglobulin family.
Research Fields
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.