TIMP2 Antibody - #DF6454

Product: | TIMP2 Antibody |
Catalog: | DF6454 |
Description: | Rabbit polyclonal antibody to TIMP2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse |
Mol.Wt.: | 24kDa; 24kD(Calculated). |
Uniprot: | P16035 |
RRID: | AB_2838417 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6454, RRID:AB_2838417.
Fold/Unfold
CSC 21K; CSC-21K; CSC21K; Metalloproteinase inhibitor 2; Metalloproteinase inhibitor 2 precursor; TIMP 2; TIMP metallopeptidase inhibitor 2; TIMP-2; TIMP2; TIMP2_HUMAN; Tissue Inhibitor of Metalloproteinase 2; Tissue inhibitor of metalloproteinases 2;
Immunogens
- P16035 TIMP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P16035 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K53 | Ubiquitination | Uniprot | |
S57 | Phosphorylation | Uniprot | |
Y62 | Phosphorylation | Uniprot | |
K67 | Ubiquitination | Uniprot | |
K74 | Ubiquitination | Uniprot | |
Y90 | Phosphorylation | Uniprot | |
Y165 | Phosphorylation | Uniprot |
Research Backgrounds
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.
The activity of TIMP2 is dependent on the presence of disulfide bonds.
Secreted.
Interacts (via the C-terminal) with MMP2 (via the C-terminal PEX domain); the interaction inhibits the MMP2 activity.
Belongs to the protease inhibitor I35 (TIMP) family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.