TIMP3 Antibody - #DF6432
![](/images/pubmed.gif)
Product: | TIMP3 Antibody |
Catalog: | DF6432 |
Description: | Rabbit polyclonal antibody to TIMP3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 24kDa; 24kD(Calculated). |
Uniprot: | P35625 |
RRID: | AB_2838395 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6432, RRID:AB_2838395.
Fold/Unfold
HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG 5 protein; MIG5 protein; Protein MIG 5; Protein MIG-5; SFD; Sorsby fundus dystrophy pseudoinflammatory; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP-3; TIMP3; TIMP3_HUMAN; Tissue Inhibitor of Metalloproteinase 3; Tissue inhibitor of metalloproteinases 3; Tissue inhibitor of metalloproteinases3;
Immunogens
- P35625 TIMP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P35625 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y100 | Phosphorylation | Uniprot | |
Y177 | Phosphorylation | Uniprot | |
Y182 | Phosphorylation | Uniprot | |
Y195 | Phosphorylation | Uniprot |
Research Backgrounds
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Secreted>Extracellular space>Extracellular matrix.
Interacts with EFEMP1.
Belongs to the protease inhibitor I35 (TIMP) family.
Research Fields
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
References
Application: WB Species: human Sample: HepG2
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.