MICA Antibody - #DF6403
| Product: | MICA Antibody |
| Catalog: | DF6403 |
| Description: | Rabbit polyclonal antibody to MICA |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 43kDa; 43kD(Calculated). |
| Uniprot: | Q29983 |
| RRID: | AB_2838366 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6403, RRID:AB_2838366.
Fold/Unfold
HLA class I antigen; FLJ36918; FLJ60820; MGC111087; MGC21250; MHC class I chain related gene A protein; MHC class I chain related protein A; MHC class I chain related protein A HLA B HLA C; MHC class I polypeptide related sequence A; MHC class I polypeptide-related sequence A; MHC class I related protein; MIC A; MIC-A; micA; MICA_HUMAN; OTTHUMP00000029088; OTTHUMP00000044528; OTTHUMP00000165170; OTTHUMP00000165172; PERB11.1; Stress inducible class I homolog;
Immunogens
Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within the medulla of normal thymus. In skin, expressed mainly in the keratin layers, basal cells, ducts and follicles. Also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In thyomas, overexpressed in cortical and medullar epithelial cells. Tumors expressing MICA display increased levels of gamma delta T-cells.
- Q29983 MICA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
PTMs - Q29983 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K94 | Ubiquitination | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| Y194 | Phosphorylation | Uniprot | |
| S197 | Phosphorylation | Uniprot | |
| T212 | Phosphorylation | Uniprot | |
| S345 | Phosphorylation | Uniprot |
Research Backgrounds
Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.
N-glycosylated. Glycosylation is not essential for interaction with KLRK1/NKG2D but enhances complex formation.
Proteolytically cleaved and released from the cell surface of tumor cells which impairs KLRK1/NKG2D expression and T-cell activation.
Cell membrane>Single-pass type I membrane protein. Cytoplasm.
Note: Expressed on the cell surface in gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm in keratinocytes and monocytes. Infection with human adenovirus 5 suppresses cell surface expression due to the adenoviral E3-19K protein which causes retention in the endoplasmic reticulum.
Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within the medulla of normal thymus. In skin, expressed mainly in the keratin layers, basal cells, ducts and follicles. Also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In thyomas, overexpressed in cortical and medullar epithelial cells. Tumors expressing MICA display increased levels of gamma delta T-cells.
Unlike classical MHC class I molecules, does not form a heterodimer with beta-2-microglobulin. Binds as a monomer to a KLRK1/NKG2D homodimer. KLRK1 forms a complex with HCST/DAP10 in which KLRK1 binds MICA while HCST acts as an adapter molecule which enables signal transduction. Interacts with PDIA6 on the surface of tumor cells, leading to disulfide bond reduction which is required for release of MICA from tumor cells. Interacts with human cytomegalovirus/HHV-5 protein UL142.
(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein UL142.
Belongs to the MHC class I family. MIC subfamily.
Research Fields
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.