Product: GHRL Antibody
Catalog: DF6389
Description: Rabbit polyclonal antibody to GHRL
Application: WB IHC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep
Mol.Wt.: 13kDa(Observed); 13kD(Calculated).
Uniprot: Q9UBU3
RRID: AB_2838352

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(83%), Bovine(%), Horse(%), Sheep(%)
Clonality:
Polyclonal
Specificity:
GHRL Antibody detects endogenous levels of total GHRL.
RRID:
AB_2838352
Cite Format: Affinity Biosciences Cat# DF6389, RRID:AB_2838352.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Appetite regulating hormone; Ghrelin 27; Ghrelin 28; Ghrelin and obestatin prepropeptide; Ghrelin; Ghrelin/obestatin prepropeptide; ghrl; GHRL_HUMAN; Growth hormone releasing peptide; Growth hormone secretagogue; Growth hormone-releasing peptide; M46 protein; Motilin related peptide; Motilin-related peptide; MTLRP; Obestatin; Protein M46;

Immunogens

Immunogen:

A synthesized peptide derived from human GHRL, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9UBU3 GHRL_HUMAN:

Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.

Description:
This gene encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Alternative promoters and alternative splicing result in multiple transcript variants, some of which encode different protein isoforms and some of which do not encode a protein but may regulate the ghrelin-obestatin preproprotein expression. In addition, antisense transcripts for this gene have been identified and may also function in regulation of the ghrelin-obestatin preproprotein expression. [provided by RefSeq, Oct 2008]
Sequence:
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
91
Sheep
89
Pig
83
Bovine
80
Rabbit
75
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.

Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility (By similarity).

PTMs:

O-octanoylation or O-decanoylation is essential for ghrelin activity. The O-decanoylated forms Ghrelin-27-C10 and Ghrelin-28-C10 differ in the length of the carbon backbone of the carboxylic acid bound to Ser-26. A small fraction of ghrelin, ghrelin-28-C10:1, may be modified with a singly unsaturated carboxylic acid.

Amidation of Leu-98 is essential for obestatin activity.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.

Family&Domains:

Belongs to the motilin family.

Research Fields

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

References

1). Maternal acrylamide exposure changes intestinal epithelium, immunolocalization of leptin and ghrelin and their receptors, and gut barrier in weaned offspring. Scientific Reports, 2023 (PubMed: 37355724) [IF=3.8]

Application: IHC    Species: Rat    Sample:

Figure 3 Quantitative analysis of the intensity of ghrelin IR in (A) villi and (B) crypts of small intestine segments, measured by comparison of the pixel brightness value in the microscopic images converted to 8-bit, grey-scale images (the higher the pixel value, the higher the intensity of the IR). (C) Representative images of the ghrelin IR in sections of proximal jejunum; inset: antibody control. Quantitative analysis of the intensity of ghrelin receptor IR in (D) villi and (E) crypts of small intestine segments, measured by comparison of the optical density (OD) of the microscopic images converted to 8-bit, grey-scale images. (F) Representative images of the ghrelin IR in sections of duodenum. (C), (F): All scale bars represent 100 µm. (A), (B), (D), (E): Bar plots show lsmeans value and standard deviation (whiskers). A p-value range was attributed above plots when two groups exhibit significant differences: *p value 

2). Basal Intestinal Morphology, Immunolocalization of Leptin and Ghrelin and Their Receptors in Newborn Wistar Rats after Prenatal Exposure to Fumonisins. Animals, 2023 (PubMed: 37174575) [IF=2.7]

Application: IHC    Species: Rat    Sample:

Figure 2 Representative images and quantitative analysis of the intensity of ghrelin, ghrelin receptor, leptin, and leptin receptor immunoreaction (IR) in crypts and villi of the duodenum of female newborn rat offspring after maternal exposure to fumonisins (FBs) at the doses of 0, 60, or 90 mg/kg b.w. Bottom isotype row shows IHC IR control incubated without a primary antibody. All of the images were taken at the same magnification; scale bars represent 50 μm. Bar charts: intensity of immunoreaction (IR) to specific antibody was measured in crypts and villi using optical density (OD) measurements in the microscopic images. Results are presented as mean and SD. Statistically significant differences between groups are indicated by

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.