PRSS1 Antibody - #DF6374
| Product: | PRSS1 Antibody |
| Catalog: | DF6374 |
| Description: | Rabbit polyclonal antibody to PRSS1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 27kDa; 27kD(Calculated). |
| Uniprot: | P07477 |
| RRID: | AB_2838338 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6374, RRID:AB_2838338.
Fold/Unfold
Alpha-trypsin chain 2; Beta-trypsin; Cationic trypsinogen; Digestive zymogen; Nonfunctional trypsin 1; Prss1; Serine protease 1; TCR V beta 4.1; TRP1; TRY1; TRY1_HUMAN; TRY4; TRYP1; Trypsin I; Trypsinogen 1; Trypsinogen A;
Immunogens
A synthesized peptide derived from human PRSS1, corresponding to a region within the internal amino acids.
- P07477 TRY1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Research Backgrounds
Has activity against the synthetic substrates Boc-Phe-Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val-Pro-Arg-Mec. The single-chain form is more active than the two-chain form against all of these substrates.
Occurs in a single-chain form and a two-chain form, produced by proteolytic cleavage after Arg-122.
Sulfation at Tyr-154 increases selectivity towards basic versus apolar residues at the P2' position of inhibitors that bind in a substrate-like fashion. Although the increase in selectivity is relatively small, it may facilitate digestion of a broader range of dietary proteins.
Secreted>Extracellular space.
Belongs to the peptidase S1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Organismal Systems > Digestive system > Pancreatic secretion.
· Organismal Systems > Digestive system > Protein digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.