Product: PLA2G2A Antibody
Catalog: DF6366
Description: Rabbit polyclonal antibody to PLA2G2A
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Horse, Rabbit
Mol.Wt.: 16kDa; 16kD(Calculated).
Uniprot: P14555
RRID: AB_2838330

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(80%), Horse(90%), Rabbit(80%)
Clonality:
Polyclonal
Specificity:
PLA2G2A Antibody detects endogenous levels of total PLA2G2A.
RRID:
AB_2838330
Cite Format: Affinity Biosciences Cat# DF6366, RRID:AB_2838330.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EC 3.1.1.4; GIIC sPLA2; Group IIA phospholipase A2; membrane associated; MOM1; Non pancreatic secretory phospholipase A2; Non-pancreatic secretory phospholipase A2; NPS PLA2; NPS-PLA2; NPSPLA2; PA2GA_HUMAN; Phosphatidylcholine 2 acylhydrolase; Phosphatidylcholine 2-acylhydrolase 2A; Phospholipase A2; Phospholipase A2 group IIA (platelets synovial fluid); Phospholipase A2 membrane associated precursor; PLA2; PLA2B; PLA2G2A; PLA2L; PLA2S; PLAS1; RASF A; RASFA; sPLA2;

Immunogens

Immunogen:

A synthesized peptide derived from human PLA2G2A, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.[provided by RefSeq, Sep 2009]
Sequence:
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
90
Pig
80
Rabbit
80
Bovine
70
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Thought to participate in the regulation of phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Independent of its catalytic activity, acts as a ligand for integrins. Binds to and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1. Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1. Induces cell proliferation in an integrin-dependent manner.

Subcellular Location:

Cell membrane>Peripheral membrane protein. Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the phospholipase A2 family.

Research Fields

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.

· Metabolism > Lipid metabolism > Ether lipid metabolism.

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Lipid metabolism > Linoleic acid metabolism.

· Metabolism > Lipid metabolism > alpha-Linolenic acid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Digestive system > Pancreatic secretion.

· Organismal Systems > Digestive system > Fat digestion and absorption.

References

1). Spatial multiomics atlas reveals smooth muscle phenotypic transformation and metabolic reprogramming in diabetic macroangiopathy. Cardiovascular diabetology, 2024 (PubMed: 39395983) [IF=9.3]

2). ERG mediates the differentiation of hepatic progenitor cells towards immunosuppressive PDGFRα+ cancer-associated fibroblasts during hepatocarcinogenesis. Cell death & disease, 2025 (PubMed: 39827226) [IF=8.1]

Application: IF/ICC    Species: Rat    Sample: HPCs

Fig. 4: Lipopolysaccharide induces the differentiation of HPCs towards PDGFRα+ CAFs. A, B Pseudotime trajectories of all CAFs revealing 3 branches. The blue, red, green and grey circles indicate cells at the termini of the branches. C Heatmap showing dynamic changes in gene expression in the CAF lineage. The genes were clustered into 3 gene sets, each of which was characterized by specific expression profiles, as depicted by a selection of genes characteristic of each cluster. Rows: GO enrichment analysis of DEGs; columns: cells shown in pseudotime order. D Expression of key regulators plotted along the pseudotime axis. E, F The expression of CAF markers (α-SMA, RGS5, and PDGFRα) was detected in HPCs treated with LPS for 7 days and 14 days by immunofluorescence staining. Nuclei were stained with DAPI (blue). G Fuzzy Cmeans clustering identified 8 distinct temporal patterns of gene expression. The x-axis shows three stages of HPCs (control and treated with LPS for 7 days and 14 days), whereas the y-axis shows the log2-transformed, normalized intensity ratios at each stage. (H Bar graphs showing the pathways identified after KEGG and GO enrichment analysis of genes in Cluster 4 and 5, respectively. I, J Volcano plot showing differentially expressed genes (DEGs) between HPCs treated with LPS for 7 days and untreated HPCs (I, left panel) or between HPCs treated with LPS for 14 days and untreated HPCs. (J left panel). The bar graphs show the Gene Ontology (GO) functional enrichment analysis results for the DEGs between the group treated with LPS for 7 days and the control group and between the group treated with LPS for 14 days and the control group.

3). Phospholipase A2 regulates autophagy in gouty arthritis: proteomic and metabolomic studies. Journal of Translational Medicine, 2023 (PubMed: 37069596) [IF=7.4]

Application: WB    Species: Human    Sample:

Fig. 6 Interactions between the proteome and metabolome, and validation of the autophagy pathway. A: Example diagram of protein and metabolism KGML network. Squares represent pathways, triangles represent proteins, and circles represent metabolites. Red indicates up-regulated proteins or green indicates down-regulated proteins or metabolites. B: The expressions of LC3B and SQSTM1/62 were evaluated by western blotting. C: The expressions of PLA2 were evaluated by western blotting. D-F: Quantification of LC3B, SQSTM1/62 and PLA2 expressions (n = 3, all the data are expressed as means ± SD, two-way ANOVA followed by Turkey's post hoc test was applied)

4). Integrating Metabolomics and Network Analyses to Explore Mechanisms of Geum japonicum var. chinense Against Pulmonary Fibrosis: Involvement of Arachidonic Acid Metabolic Pathway. International journal of molecular sciences, 2025 (PubMed: 40003932) [IF=5.6]

Application: WB    Species: Mouse    Sample:

Figure 9. The effect of GJC aqueous extract on the AA metabolic pathway in PF mice. (A) The protein bands of ALOX5, PTGS2, PTGS1, CYP2C9, PLA2G2A, and GAPDH, (B–F) The expression of ALOX5, PTGS2, PTGS1, CYP2C9, and PLA2G2A in lung tissues. The values represent the mean ± SEM (n = 3).

5). Identification and immunological characterization of PLA2G2A and cell death-associated molecular clusters in idiopathic pulmonary fibrosis. Life Sciences, 2023 (PubMed: 37673297) [IF=5.2]

6). Myocardial Lipidomics Revealed Glycerophospholipid and Sphingolipid Metabolism as Therapeutic Targets of Qifu Decoction Against Heart Failure. Biomedical chromatography : BMC, 2025 (PubMed: 40110617) [IF=1.8]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.