AKR7A2 Antibody - #DF6359
Product: | AKR7A2 Antibody |
Catalog: | DF6359 |
Description: | Rabbit polyclonal antibody to AKR7A2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Dog |
Mol.Wt.: | 40kDa; 40kD(Calculated). |
Uniprot: | O43488 |
RRID: | AB_2838323 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6359, RRID:AB_2838323.
Fold/Unfold
AFAR; AFAR1; AFB1 aldehyde reductase 1; AFB1 AR1; AFB1-AR 1; AFB1AR1; Aflatoxin aldehyde reductase; Aflatoxin B1 aldehyde reductase member 2; Aflatoxin beta1 aldehyde reductase; Aiar; AKR7; Akr7a2; Aldo keto reductase family 7; Aldo keto reductase family 7 member A2 aflatoxin aldehyde reductase; Aldo keto reductase family 7 member A2; Aldo keto reductase family 7, member A2 (aflatoxin aldehyde reductase); Aldoketoreductase 7; ARK72_HUMAN; SSA reductase; Succinic semialdehyde reductase;
Immunogens
Detected in brain, liver, small intestine and testis, and at lower levels in heart, prostate, skeletal muscle and spleen. Detected in kidney proximal and distal tubules, endothelial cells lining the Bowman's capsules and some cysts. Detected at low levels in lung and pancreas (at protein level). Widely expressed.
- O43488 ARK72_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O43488 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S20 | Phosphorylation | Uniprot | |
S40 | Phosphorylation | Uniprot | |
S56 | Phosphorylation | Uniprot | |
R61 | Methylation | Uniprot | |
S78 | Phosphorylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K112 | Ubiquitination | Uniprot | |
K115 | Ubiquitination | Uniprot | |
S118 | Phosphorylation | Uniprot | |
K128 | Acetylation | Uniprot | |
K128 | Ubiquitination | Uniprot | |
Y223 | Phosphorylation | Uniprot | |
Y225 | Phosphorylation | Uniprot | |
K236 | Ubiquitination | Uniprot | |
R250 | Methylation | Uniprot | |
S255 | Phosphorylation | Uniprot | |
T259 | Phosphorylation | Uniprot | |
S287 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the NADPH-dependent reduction of succinic semialdehyde to gamma-hydroxybutyrate. May have an important role in producing the neuromodulator gamma-hydroxybutyrate (GHB). Has broad substrate specificity. Has NADPH-dependent aldehyde reductase activity towards 2-carboxybenzaldehyde, 2-nitrobenzaldehyde and pyridine-2-aldehyde (in vitro). Can reduce 1,2-naphthoquinone and 9,10-phenanthrenequinone (in vitro). Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen.
Golgi apparatus. Cytoplasm.
Detected in brain, liver, small intestine and testis, and at lower levels in heart, prostate, skeletal muscle and spleen. Detected in kidney proximal and distal tubules, endothelial cells lining the Bowman's capsules and some cysts. Detected at low levels in lung and pancreas (at protein level). Widely expressed.
Homodimer.
Belongs to the aldo/keto reductase family. Aldo/keto reductase 2 subfamily.
Research Fields
· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.