CST8 Antibody - #DF6356
Product: | CST8 Antibody |
Catalog: | DF6356 |
Description: | Rabbit polyclonal antibody to CST8 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 16kDa; 16kD(Calculated). |
Uniprot: | O60676 |
RRID: | AB_2838320 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6356, RRID:AB_2838320.
Fold/Unfold
CRES; CST 8; Cst8; CST8_HUMAN; cystatin 8 (cystatin related epididymal specific); Cystatin 8; Cystatin related epididymal specific; Cystatin related epididymal specific protein; Cystatin related epididymal spermatogenic protein; Cystatin related protein epididymis specific; Cystatin-8; Cystatin-related epididymal spermatogenic protein;
Immunogens
Proximal caput region of the epididymis. Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium.
- O60676 CST8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRCRWLSLILLTIPLALVARKDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
PTMs - O60676 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N39 | N-Glycosylation | Uniprot | |
K97 | Acetylation | Uniprot | |
K114 | Acetylation | Uniprot | |
K116 | Acetylation | Uniprot |
Research Backgrounds
Performs a specialized role during sperm development and maturation.
Secreted.
Proximal caput region of the epididymis. Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium.
Belongs to the cystatin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.