APOH Antibody - #DF6352
| Product: | APOH Antibody |
| Catalog: | DF6352 |
| Description: | Rabbit polyclonal antibody to APOH |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 38kDa; 38kD(Calculated). |
| Uniprot: | P02749 |
| RRID: | AB_2838316 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6352, RRID:AB_2838316.
Fold/Unfold
Activated protein C binding protein; Activated protein C-binding protein; Anticardiolipin cofactor; APC inhibitor; Apo-H; APOH; APOH_HUMAN; apolipoprotein H (beta-2-glycoprotein I); Apolipoprotein H; B2G1; B2GP1; B2GPI; Beta 2 glycoprotein I; Beta 2 glycoprotein I precursor; Beta(2)GPI; Beta-2-glycoprotein 1; Beta-2-glycoprotein I; BG; Glycoprotein 1, beta-2; Glycoprotein I, beta-2; OTTMUSP00000003033;
Immunogens
- P02749 APOH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P02749 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| N162 | N-Glycosylation | Uniprot | |
| N183 | N-Glycosylation | Uniprot | |
| N193 | N-Glycosylation | Uniprot | |
| N253 | N-Glycosylation | Uniprot | |
| T272 | Phosphorylation | Uniprot | |
| C300 | S-Nitrosylation | Uniprot | |
| K301 | Methylation | Uniprot |
Research Backgrounds
Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells.
N- and O-glycosylated.also reports glycosylation on 'Asn-188' for their allele.
Secreted.
Expressed by the liver and secreted in plasma.
Research Fields
· Organismal Systems > Digestive system > Cholesterol metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.