ARHGDIA Antibody - #DF6346
Product: | ARHGDIA Antibody |
Catalog: | DF6346 |
Description: | Rabbit polyclonal antibody to ARHGDIA |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 28kDa; 23kD(Calculated). |
Uniprot: | P52565 |
RRID: | AB_2838310 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6346, RRID:AB_2838310.
Fold/Unfold
ARHGDIA; fa96g11; GDIA 1; GDIA1; GDIR1_HUMAN; MGC117248; NPHS8; Rho GDI 1; Rho GDI alpha; Rho GDI; Rho GDP dissociation inhibitor (GDI) alpha; Rho GDP dissociation inhibitor 1; Rho GDP dissociation inhibitor alpha; Rho GDP-dissociation inhibitor 1; Rho-GDI alpha; RhoGDI 1; RhoGDI alpha; RHOGDI; RhoGDI1; wu:fa96g11; zgc:55554; zgc:77681;
Immunogens
- P52565 GDIR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P52565 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S24 | Phosphorylation | Uniprot | |
Y27 | Phosphorylation | P12931 (SRC) | Uniprot |
K28 | Acetylation | Uniprot | |
K28 | Ubiquitination | Uniprot | |
S34 | Phosphorylation | P17252 (PRKCA) | Uniprot |
K43 | Acetylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
S47 | Phosphorylation | Uniprot | |
Y51 | Phosphorylation | Uniprot | |
K52 | Acetylation | Uniprot | |
K52 | Methylation | Uniprot | |
K52 | Ubiquitination | Uniprot | |
S96 | Phosphorylation | P17252 (PRKCA) | Uniprot |
K99 | Ubiquitination | Uniprot | |
S101 | Phosphorylation | Q13153 (PAK1) | Uniprot |
K105 | Acetylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K127 | Acetylation | Uniprot | |
K127 | Ubiquitination | Uniprot | |
T132 | Phosphorylation | Uniprot | |
Y133 | Phosphorylation | Uniprot | |
K138 | Sumoylation | Uniprot | |
K141 | Acetylation | Uniprot | |
K141 | Sumoylation | Uniprot | |
K141 | Ubiquitination | Uniprot | |
S148 | Phosphorylation | Uniprot | |
Y156 | Phosphorylation | P12931 (SRC) | Uniprot |
T160 | Phosphorylation | Uniprot | |
K167 | Acetylation | Uniprot | |
K167 | Ubiquitination | Uniprot | |
S174 | Phosphorylation | P17612 (PRKACA) , Q13153 (PAK1) | Uniprot |
K178 | Acetylation | Uniprot | |
K178 | Ubiquitination | Uniprot |
Research Backgrounds
Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.
Cytoplasm.
Monomer (By similarity). Interacts with FER. Interacts with PLXNB3 (By similarity). Forms a heterodimer with RAC1. Interacts with RHOA, the affinity is increased by three orders of magnitude when RHOA is prenylated. Interacts with PSMD10; the interaction increases ARHGDIA association with RHOA, leading to ARHGDIA-mediated inactivation of RHOA and ROCK and prolonged AKT activation. Interacts with KANK2; the interaction is direct and may regulate the interaction of ARHGDIA with RHOA, RAC1 and CDC42. Interacts with RHOC. Interacts with CDC42. Interacts with NGFR (via death domain); NGFR binding decreases the affinity for RHOA.
Belongs to the Rho GDI family.
Research Fields
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.