Product: PDGFB Antibody
Catalog: DF6328
Description: Rabbit polyclonal antibody to PDGFB
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Rabbit
Mol.Wt.: 27kDa; 27kD(Calculated).
Uniprot: P01127
RRID: AB_2838292

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Rabbit(86%)
Clonality:
Polyclonal
Specificity:
PDGFB Antibody detects endogenous levels of total PDGFB.
RRID:
AB_2838292
Cite Format: Affinity Biosciences Cat# DF6328, RRID:AB_2838292.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Becaplermin; PDGF 2; PDGF B chain; PDGF subunit B; PDGF-2; PDGF2; Pdgfb; PDGFB_HUMAN; Platelet derived growth factor 2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Platelet-derived growth factor subunit B; Proto-oncogene c-Sis; SIS; SSV;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P01127 PDGFB_HUMAN:

Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.

Description:
PDGF-BB is a cystine-linked homodimer PDGF family member with key roles in development, cell proliferation, cell survival, and angiogenesis (1,2). PDGF-BB is expressed by vascular endothelium, megakaryocytes and Leydig cells (2). PDGF-BB targets pericytes, fibroblasts, monocytes and other cell types (1-3). PDGF induces fibroblast growth and migration (3) and is a chemoattractant for monocytes and granulocytes. Precursor PDGF-BB is cleaved intracellularly to generate a form that contains a carboxy-terminal stretch that serves to retain PDGF-BB in the extracellular matrix. In a second cleavage event, the carboxy-terminal stretch is removed extracellularly to generate mature PDGF-BB (1,2). PDGF-BB binds to PDGFRβ and induces receptor dimerization. Signaling is through the PI3K/Akt, JNK, and PLCγ pathways (1, 2). PDGF-BB may have a role in some cancer types (2).
Sequence:
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
86
Pig
0
Horse
0
Bovine
0
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01127 As Substrate

Site PTM Type Enzyme
T190 O-Glycosylation
S196 Phosphorylation

Research Backgrounds

Function:

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity).

Subcellular Location:

Secreted.
Note: Released by platelets upon wounding.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.

Subunit Structure:

Antiparallel homodimer; disulfide-linked. Antiparallel heterodimer with PDGFA; disulfide-linked. The PDGFB homodimer interacts with PDGFRA and PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. The heterodimer composed of PDGFA and PDGFB interacts with PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. Interacts with XLKD1 (By similarity). Interacts with LRP1. Interacts with SORL1 (via the N-terminal ectodomain).

Family&Domains:

Belongs to the PDGF/VEGF growth factor family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Renal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer.   (View pathway)

References

1). Neonatal stress disrupts the glymphatic system development and increases the susceptibility to Parkinson's disease in later life. CNS neuroscience & therapeutics, 2024 (PubMed: 38421142) [IF=5.5]

Application: WB    Species: Mouse    Sample: brains

FIGURE 5 NMD decreases the expression of PDGF‐B and PDGFR‐β in the brains of young and adult mice. (A–D) WB analyses of protein extracts from the hippocampus (HPC) and frontal cortex (FC), normalized to β‐Actin level. (A, sB) WB showing the expression of PDGF‐B in the HPC and FC of young (A, n = 5 per group) and adult mice (B, n = 8 per group). (C, D) WB showing the expression of PDGFR‐β in the HPC and FC of young (C, n = 5 per group) and adult mice (D, n = 6 per group). (E–H) qPCR analysis of the mRNA level of agrin and laminin in brain tissues, expressed as the relative expression ratio normalized to the CON group. (E, F) qPCR showing the mRNA level of agrin in the HPC and FC of young (E, n = 6 per group) and adult mice (F, n = 7 per group). (G, H) qPCR showing the mRNA level of laminin in the HPC and FC of young (G, n = 5–6 per group) and adult mice (H, n = 7 per group). *p 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.