TNFRSF10C Antibody - #DF6271

(1)  
Product: TNFRSF10C Antibody
Catalog: DF6271
Description: Rabbit polyclonal antibody to TNFRSF10C
Application: WB IHC
Reactivity: Human, Rat
Mol.Wt.: 27kDa; 27kD(Calculated).
Uniprot: O14798
RRID: AB_2838237

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
TNFRSF10C Antibody detects endogenous levels of total TNFRSF10C.
RRID:
AB_2838237
Cite Format: Affinity Biosciences Cat# DF6271, RRID:AB_2838237.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Antagonist decoy receptor for TRAIL/Apo 2L; CD263; Cytotoxic TRAIL receptor 3; DCR1; DCR1 TNFR; Decoy Receptor 1; Decoy TRAIL receptor without death domain; LIT; Lymphocyte inhibitor of TRAIL; MGC149501; MGC149502; TNF related apoptosis inducing ligand receptor 3; TNF-re ated apoptosis inducing ligand receptor 3; TNFRSF10C; TRAIL R3; TRAIL receptor 3; TRAILR3; TRID; Tumor necrosis factor receptor superfamily member 10C; Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain;

Immunogens

Immunogen:
Uniprot:

O14798(TR10C_HUMAN) >>Visit HPA database.

Gene(ID):
TNFRSF10C(8794)
Expression:
O14798 TR10C_HUMAN:

Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.

Description:
The tumor necrosis factor receptor family, which includes TNF-RI, Fas, DR3, DR4, DR5, and DR6, plays an important role in the regulation of apoptosis in various physiological systems (1,2). The receptors are activated by a family of cytokines that include TNF, FasL, and TRAIL. They are characterized by a highly conserved extracellular region containing cysteine-rich repeats and a conserved intracellular region of about 80 amino acids termed the death domain (DD). The DD is important for transducing the death signal by recruiting other DD containing adaptor proteins (FADD, TRADD, RIP) to the death-inducing signaling complex (DISC), resulting in activation of caspases. Death receptor signaling is also controlled by a family of decoy receptors (DcR1, DcR2 and DcR3) which lack a cytoplasmic DD and inhibit death receptor-mediated apoptosis by competing for ligand (3-5). Expression of decoy receptors provide a mechanism for certain types of cancer to regulate apoptosis and can contribute to chemosensitivity (6-8).
Sequence:
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV

PTMs - O14798 As Substrate

Site PTM Type Enzyme
S99 Phosphorylation
S100 Phosphorylation

Research Backgrounds

Function:

Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.

PTMs:

N-glycosylated and O-glycosylated.

Subcellular Location:

Cell membrane>Lipid-anchor.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.