AMACR Antibody - #DF6265
Product: | AMACR Antibody |
Catalog: | DF6265 |
Description: | Rabbit polyclonal antibody to AMACR |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 42kDa; 42kD(Calculated). |
Uniprot: | Q9UHK6 |
RRID: | AB_2838231 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6265, RRID:AB_2838231.
Fold/Unfold
2 arylpropionyl CoA epimerase; 2 methylacyl CoA racemase; 2-methylacyl-CoA racemase; Alpha methylacyl CoA racemase; Alpha methylacyl Coenzyme A racemase; Alpha methylacyl-CoA racemase deficiency, included; Alpha-methylacyl-CoA racemase; Amacr; AMACR deficiency, included; AMACR_HUMAN; CBAS4; Da1-8; EC 5.1.99.4; Macr1; Methylacyl CoA racemase alpha; RACE; RM;
Immunogens
- Q9UHK6 AMACR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVIDANMVEGTAYLSSFLWKTQKLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNKVKASL
PTMs - Q9UHK6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K58 | Ubiquitination | Uniprot | |
K87 | Ubiquitination | Uniprot | |
Y126 | Phosphorylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
Y365 | Phosphorylation | Uniprot | |
K371 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the interconversion of (R)- and (S)-stereoisomers of alpha-methyl-branched-chain fatty acyl-CoA esters. Acts only on coenzyme A thioesters, not on free fatty acids, and accepts as substrates a wide range of alpha-methylacyl-CoAs, including pristanoyl-CoA, trihydroxycoprostanoyl-CoA (an intermediate in bile acid synthesis), and arylpropionic acids like the anti-inflammatory drug ibuprofen (2-(4-isobutylphenyl)propionic acid) but neither 3-methyl-branched nor linear-chain acyl-CoAs.
Peroxisome. Mitochondrion.
Monomer.
Belongs to the CoA-transferase III family.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
· Metabolism > Lipid metabolism > Primary bile acid biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.