Product: APOA1 Antibody
Catalog: DF6264
Source: Rabbit
Application: WB, IHC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 31kD; 31kD(Calculated).
Uniprot: P02647
RRID: AB_2838230

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(86%), Sheep(100%), Rabbit(86%), Dog(100%)
Clonality:
Polyclonal
Specificity:
APOA1 Antibody detects endogenous levels of total APOA1.
RRID:
AB_2838230
Cite Format: Affinity Biosciences Cat# DF6264, RRID:AB_2838230.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apo-AI; ApoA I; ApoA-I; APOA1; APOA1_HUMAN; Apolipoprotein A-I(1-242); Apolipoprotein A1; Apolipoprotein AI; Brp14; Ltw1; Lvtw1; Sep1; Sep2;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P02647 APOA1_HUMAN:

Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease.

Description:
ApoAI (Apolipoprotein A1) is a major component of high density lipoprotein (HDL, the “good cholesterol”) in plasma. It is produced in the liver and small intestine. ApoA1 is a cofactor for lecithin cholesterolacyltransferase (LCAT) that is responsible for the formation of plasma cholesteryl esters and promotes cholesterol efflux from tissues to the liver for excretion. Defects in ApoA1 are associated with high density lipoprotein deficiency (HDLD) and systemic non-neuropathic amyloidosis (1-3).
Sequence:
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Dog
100
Horse
86
Rabbit
86
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P02647 As Substrate

Site PTM Type Enzyme
Y53 Phosphorylation
S55 Phosphorylation
S60 Phosphorylation
K130 Acetylation
K142 Ubiquitination
S166 Phosphorylation
T185 Phosphorylation
Y190 Phosphorylation
S191 Phosphorylation
Y216 Phosphorylation
K219 Acetylation
T221 O-Glycosylation
T221 Phosphorylation
S225 Phosphorylation
T226 Phosphorylation
S228 O-Glycosylation
S252 Phosphorylation
K262 Acetylation

Research Backgrounds

Function:

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.

PTMs:

Glycosylated.

Palmitoylated.

Phosphorylation sites are present in the extracellular medium.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease.

Subunit Structure:

Interacts with APOA1BP and CLU. Component of a sperm activating protein complex (SPAP), consisting of APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain and albumin. Interacts with NDRG1. Interacts with SCGB3A2.

Family&Domains:

Belongs to the apolipoprotein A1/A4/E family.

Research Fields

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Digestive system > Fat digestion and absorption.

· Organismal Systems > Digestive system > Vitamin digestion and absorption.

· Organismal Systems > Digestive system > Cholesterol metabolism.

References

1). Yuan P et al. Neural stem cell-derived exosomes regulate neural stem cell differentiation through miR-9-Hes1 axis. Front Cell Dev Biol 2021 May 13;9:601600. (PubMed: 34055767) [IF=6.081]

Application: WB    Species: Mouse    Sample: neural stem cells (NSC)

FIGURE 1 Characterization of exosomes (EXOs). (A) Purified exosomes were observed under transmission electron microscopy (TEM) using negative staining. (B) The levels of positive exosomal markers TSG101, CD9, and Flotillin-1 in protein lysates of neural stem cells (NSC)-derived exosome pellets were determined by western blotting. (C) The levels of negative exosomal markers APOA1 and APOA2 in protein lysates of NSC-derived exosome pellets and NSCs were determined by western blotting. (D,E) Particle-size distribution of exosomes was determined by NanoSight analysis (NTA) in panel (D) and NanoFCM in panel (E) technologies. Scale bar 200 nm in panel (A).

Application: WB    Species: mouse    Sample: NSCs

FIGURE 1 | Characterization of exosomes (EXOs). (C) The levels of negative exosomal markers APOA1 and APOA2 in protein lysates of NSC-derived exosome pellets and NSCs were determined by western blotting.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.