LYZL6 Antibody - #DF6212
Product: | LYZL6 Antibody |
Catalog: | DF6212 |
Description: | Rabbit polyclonal antibody to LYZL6 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 17kDa; 17kD(Calculated). |
Uniprot: | O75951 |
RRID: | AB_2838178 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6212, RRID:AB_2838178.
Fold/Unfold
EC 3.2.1.17; LYC1; Lysozyme homolog; Lysozyme like 6; UNQ754/PRO1485;
Immunogens
Expressed in testis, epididymis and spermatozoa (at protein level) (PubMed:16014814, PubMed:28182716). Expressed in late-stage spermatocytes and round spermatids (PubMed:28182716).
- O75951 LYZL6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
PTMs - O75951 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S134 | Phosphorylation | Uniprot | |
Y140 | Phosphorylation | Uniprot |
Research Backgrounds
May be involved sperm-egg plasma membrane adhesion and fusion during fertilization. Exhibits bacteriolytic activity in vitro against Micrococcus luteus and Staphylococcus aureus. Shows weak bacteriolytic activity against Gram-positive bacteria at physiological pH. Bacteriolytic activity is pH-dependent, with a maximum at around pH 5.6.
Secreted. Cell surface. Cell projection>Cilium>Flagellum.
Note: Detected on the postacrosomal membrane of mature spermatozoa (PubMed:28182716).
Expressed in testis, epididymis and spermatozoa (at protein level). Expressed in late-stage spermatocytes and round spermatids.
Monomer.
Belongs to the glycosyl hydrolase 22 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.