Product: CALR Antibody
Catalog: DF6211
Description: Rabbit polyclonal antibody to CALR
Application: WB IHC IF/ICC
Cited expt.: IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Rabbit
Mol.Wt.: 60kDa; 48kD(Calculated).
Uniprot: P27797
RRID: AB_2838177

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
CALR Antibody detects endogenous levels of total CALR.
RRID:
AB_2838177
Cite Format: Affinity Biosciences Cat# DF6211, RRID:AB_2838177.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Autoantigen RO; CALR; CALR protein; CALR_HUMAN; Calregulin; Calreticulin; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; Epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL S 99n; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); Sicca syndrome antigen A; SSA;

Immunogens

Immunogen:

A synthesized peptide derived from human CALR, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
Calcium is a universal signaling molecule involved in many cellular functions such as cell motility, metabolism, protein modification, protein folding and apoptosis. Calcium is stored in the endoplasmic reticulum (ER), where it is buffered by calcium binding chaperones such as calnexin and calreticulin, and is released via the IP3 Receptor (1). Calreticulin also functions as an ER chaperone that ensures proper folding and quality control of newly synthesized glycoproteins. As such, calreticulin presumably does not alter protein folding but ensures proper timing for efficient folding and subunit assembly. Furthermore, calreticulin retains proteins in non-native conformation within the ER and targets them for degradation (2,3).
Sequence:
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Rabbit
100
Xenopus
45
Zebrafish
45
Dog
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity).

Subcellular Location:

Endoplasmic reticulum lumen. Cytoplasm>Cytosol. Secreted>Extracellular space>Extracellular matrix. Cell surface. Sarcoplasmic reticulum lumen.
Note: Also found in cell surface (T cells), cytosol and extracellular matrix (PubMed:10358038). Associated with the lytic granules in the cytolytic T-lymphocytes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. The P-domain binds one molecule of calcium with high affinity, whereas the acidic C-domain binds multiple calcium ions with low affinity.

The interaction with glycans occurs through a binding site in the globular lectin domain.

The zinc binding sites are localized to the N-domain.

Associates with PDIA3 through the tip of the extended arm formed by the P-domain.

Belongs to the calreticulin family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

References

1). A Vanadium-Based Nanoplatform Synergizing Ferroptotic-like Therapy with Glucose Metabolism Intervention for Enhanced Cancer Cell Death and Antitumor Immunity. ACS Nano, 2023 (PubMed: 37272777) [IF=15.8]

2). Photosynthetic Bacteria-Hitchhiking 2D iMXene-mRNA Vaccine to Enable Photo-Immunogene Cancer Therapy. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38742454) [IF=15.1]

3). A precision intelligent nanomissile for inhibiting tumor metastasis, boosting energy deprivation and immunotherapy. Biomaterials, 2025 (PubMed: 39531747) [IF=12.8]

4). Discovery of a Novel Benzimidazole Derivative Targeting Histone Deacetylase to Induce Ferroptosis and Trigger Immunogenic Cell Death. Journal of medicinal chemistry, 2024 (PubMed: 39145486) [IF=6.8]

5). Microneedle-mediated multifunctional nano-transdermal therapy system for in situ synergistic treatment of melanoma. Colloids and Surfaces A: Physicochemical and Engineering Aspects, 2025 [IF=4.9]

6). Precision USPIO-PEG-SLex Nanotheranostic Agent Targeted Photothermal Therapy for Enhanced Anti-PD-L1 Immunotherapy to Treat Immunotherapy Resistance. International Journal of Nanomedicine, 2024

Application: IF/ICC    Species: Mouse    Sample: tumor tissues

Figure 8 The images of immunohistochemical (IHC) staining assessing Ki67 expression and immunofluorescence analysis of CRT and HMGB1 about the primary tumor tissues. (A) IHC staining assessing Ki67 expression of the tumor cells proliferation. Scale bars represent 100 μm. (B) Immunofluorescence analysis of calreticulin (CRT) expression from primary tumor tissues of the four different groups (scale bar: 10 μm). (C) Fluorescence quantitative fluorescence analysis of CRT. (D) Immunofluorescence analysis of high mobility group box-1 protein (HMGB1) expression from primary tumor tissues of the four different groups (scale bar: 10 μm). (E) Quantitative fluorescence analysis of HMGB1. Three randomly chosen visual fields were evaluated for histological quantification. Data are represented as mean ± SD.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.