RHOC Antibody - #DF6207
Product: | RHOC Antibody |
Catalog: | DF6207 |
Description: | Rabbit polyclonal antibody to RHOC |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Dog, Chicken |
Mol.Wt.: | 22kDa; 22kD(Calculated). |
Uniprot: | P08134 |
RRID: | AB_2838173 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6207, RRID:AB_2838173.
Fold/Unfold
ARH12; ARHA; H12; ras homolog gene family member A; ras homolog gene family member B; ras homolog gene family member C; Rho cDNA clone 12; RHO12; RHOA; RHOA_HUMAN; rhob; rhoc; RHOH12; Small GTP binding protein RhoA; Transforming protein RhoA;
Immunogens
- P08134 RHOC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P08134 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K7 | Ubiquitination | Uniprot | |
T19 | Phosphorylation | Uniprot | |
S26 | Phosphorylation | Uniprot | |
K27 | Sumoylation | Uniprot | |
Y34 | Phosphorylation | Uniprot | |
T60 | Phosphorylation | Uniprot | |
Y66 | Phosphorylation | Uniprot | |
K104 | Ubiquitination | Uniprot | |
C107 | S-Nitrosylation | Uniprot | |
K118 | Ubiquitination | Uniprot | |
K119 | Methylation | Uniprot | |
K119 | Ubiquitination | Uniprot | |
K135 | Ubiquitination | Uniprot | |
S152 | Phosphorylation | Uniprot | |
Y156 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot |
Research Backgrounds
Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.
(Microbial infection) Glycosylated at Tyr-34 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of Rho and leads to actin disassembly.
Cell membrane>Lipid-anchor>Cytoplasmic side. Cleavage furrow.
Note: Translocates to the equatorial region before furrow formation in a ECT2-dependent manner.
Interacts with RTKN (By similarity). Interacts with AKAP13. Interacts with DIAPH1. Interacts with PKN2. Interacts with ROCK1 and ROCK2. Interacts with ARHGDIA. Interacts with RIPOR1.
Belongs to the small GTPase superfamily. Rho family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.