14-3-3 sigma Antibody - #DF6189
Product: | 14-3-3 sigma Antibody |
Catalog: | DF6189 |
Description: | Rabbit polyclonal antibody to 14-3-3 sigma |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 28kDa; 28kD(Calculated). |
Uniprot: | P31947 |
RRID: | AB_2838155 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6189, RRID:AB_2838155.
Fold/Unfold
14 3 3 protein sigma; 14-3-3 protein sigma; 1433S_HUMAN; Epithelial cell marker protein 1; Er; HME 1; HME1; MGC143283; Mkrn3; Mme1; OTTHUMP00000004242; RP23 137L22.11; SFN; SFN protein; Stratifin; YWHAS;
Immunogens
Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
- P31947 1433S_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P31947 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S5 | Phosphorylation | Uniprot | |
K9 | Ubiquitination | Uniprot | |
K11 | Acetylation | Uniprot | |
K11 | Ubiquitination | Uniprot | |
Y19 | Phosphorylation | Uniprot | |
K32 | Acetylation | Uniprot | |
K32 | Ubiquitination | Uniprot | |
C38 | S-Nitrosylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
Y48 | Phosphorylation | Uniprot | |
K49 | Acetylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
S63 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
K68 | Ubiquitination | Uniprot | |
S69 | Phosphorylation | Uniprot | |
S74 | Phosphorylation | Uniprot | |
K77 | Ubiquitination | Uniprot | |
K87 | Ubiquitination | Uniprot | |
K109 | Ubiquitination | Uniprot | |
S116 | Phosphorylation | Uniprot | |
K122 | Acetylation | Uniprot | |
K122 | Ubiquitination | Uniprot | |
K124 | Ubiquitination | Uniprot | |
Y127 | Phosphorylation | Uniprot | |
Y128 | Phosphorylation | Uniprot | |
T136 | Phosphorylation | Uniprot | |
K140 | Ubiquitination | Uniprot | |
K141 | Acetylation | Uniprot | |
S146 | Phosphorylation | Uniprot | |
S149 | Phosphorylation | Uniprot | |
Y151 | Phosphorylation | Uniprot | |
K159 | Acetylation | Uniprot | |
K160 | Ubiquitination | Uniprot | |
S186 | Phosphorylation | P53779 (MAPK10) , P45983 (MAPK8) , P45984 (MAPK9) | Uniprot |
T207 | Phosphorylation | Uniprot | |
S209 | Phosphorylation | Uniprot | |
S216 | Phosphorylation | Uniprot | |
T217 | Phosphorylation | Uniprot | |
S248 | Phosphorylation | Uniprot |
Research Backgrounds
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.
p53-regulated inhibitor of G2/M progression.
Ubiquitinated. Ubiquitination by RFFL induces proteasomal degradation and indirectly regulates p53/TP53 activation.
Cytoplasm. Nucleus. Secreted.
Note: May be secreted by a non-classical secretory pathway.
Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
Homodimer. Interacts with KRT17 and SAMSN1 (By similarity). Found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29 and VPS35. Interacts with GAB2. Interacts with SRPK2. Interacts with COPS6. Interacts with COP1; this interaction leads to proteasomal degradation. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB. Interacts with SLITRK1. Interacts with LRRK2; this interaction is dependent on LRRK2 phosphorylation.
Belongs to the 14-3-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)
· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.