Product: CEACAM5 Antibody
Catalog: DF6152
Description: Rabbit polyclonal antibody to CEACAM5
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 77kDa; 77kD(Calculated).
Uniprot: P06731
RRID: AB_2838119

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CEACAM5 Antibody detects endogenous levels of total CEACAM5.
RRID:
AB_2838119
Cite Format: Affinity Biosciences Cat# DF6152, RRID:AB_2838119.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Carcinoembryonic antigen; Carcinoembryonic antigen-related cell adhesion molecule 5; CD66e; CEA; Ceacam5; CEAM5_HUMAN; DKFZp781M2392; Meconium antigen 100; OTTHUMP00000199032; OTTHUMP00000199033; OTTHUMP00000199034;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P06731 CEAM5_HUMAN:

Expressed in columnar epithelial and goblet cells of the colon (at protein level) (PubMed:10436421). Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon.

Description:
Carcinoembryonic antigen (CEA), also known as CD66e or CEACAM5, is a 180-200 kDa cell surface glycoprotein whose expression is elevated in intestinal carcinomas and other tumors. CEA mediates cell adhesion, though little more is known about its biological activity. Expression of CEA is correlated with tumerogenicity (1), and it has been shown to play a role in cell migration, adhesion and invasion in culture cells, as well as in metastasis in vivo (2).
Sequence:
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI

PTMs - P06731 As Substrate

Site PTM Type Enzyme
T199 Phosphorylation
T201 Phosphorylation
T206 Phosphorylation
Y213 Phosphorylation
S226 Phosphorylation
N246 N-Glycosylation
S404 Phosphorylation
T419 Phosphorylation
S421 Phosphorylation
T476 Phosphorylation
N560 N-Glycosylation
S680 Phosphorylation

Research Backgrounds

Function:

Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells.

(Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer.

PTMs:

Complex immunoreactive glycoprotein with a MW of 180 kDa comprising 60% carbohydrate.

Subcellular Location:

Cell membrane>Lipid-anchor. Apical cell membrane. Cell surface.
Note: Localized to the apical glycocalyx surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in columnar epithelial and goblet cells of the colon (at protein level). Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon.

Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the immunoglobulin superfamily. CEA family.

References

1). Compared with High-intensity Interval Exercise, Moderate Intensity Constant Load Exercise is more effective in curbing the Growth and Metastasis of Lung Cancer. Journal of Cancer, 2022 (PubMed: 35371324) [IF=3.9]

Application: IHC    Species: mouse    Sample: lung cancer

Figure S3: | A: IHC staining of lung cancer tissues TTF-1, CEA and P63 (n=3). B, C: Effect of nuclear TTF-1 expression in lung tissue of mice with lung cancer (n=6).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.